KEGG   Bacillus subtilis subsp. subtilis 168: BSU15980
Entry
BSU15980          CDS       T00010                                 

Symbol
ffh
Name
(RefSeq) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03060  Protein export
bsu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BSU15980 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BSU15980 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU15980 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU15980 (ffh)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     BSU15980 (ffh)
Secretion system [BR:bsu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BSU15980 (ffh)
  Eukaryotic Sec-SRP protein
   BSU15980 (ffh)
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N Zeta_toxin AAA_33 AAA_17 CbiA AAA_31 6PF2K AAA_30 AAA_22 ResIII APS_kinase cobW AAA_24 DDT AAA_28 AAA_16 AAA_18 DUF3618 MMR_HSR1
Other DBs
NCBI-GeneID: 937104
NCBI-ProteinID: NP_389480
Pasteur: BG10830
BSORF: BG10830
UniProt: P37105 A0A6M3ZAQ7
Structure
PDB: 
4UE4

Position
1672174..1673514
AA seq 446 aa
MAFEGLADRLQQTISKIRGKGKVSEQDVKEMMREVRLALLEADVNFKVVKDFVKKVSERA
VGQDVMKSLTPGQQVIKVVQEELTELMGGEESKIAVAKRPPTVIMMVGLQGAGKTTTSGK
LANLLRKKHNRKPMLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIEKA
KEEHYDYVILDTAGRLHIDHELMDELTNVKEIANPEEIFLVVDSMTGQDAVNVAKSFNEQ
LGLTGVVLTKLDGDTRGGAALSIRAVTNTPIKFAGLGEKLDALEPFHPERMASRILGMGD
VLTLIEKAQASVDEDKAKELEQKMRTMSFTLDDFLEQLGQVRNMGPLDELLQMMPGAGKM
KGLKNIQVDEKQLNHVEAIIKSMTVLEKEQPDIINASRRKRIAKGSGTSVQEVNRLLKQF
DEMKKMMKQMTNMSKGKKKGFKLPFM
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggcatttgaaggattagccgaccgactgcagcagacgatttctaaaatccgcggaaaa
gggaaagtcagcgaacaagatgtaaaagagatgatgcgtgaggtccgtcttgcgctgctt
gaggctgacgttaactttaaagtagtcaaggattttgtcaaaaaagtaagtgaacgcgct
gtaggccaagacgtcatgaaaagtctgacgcccggccagcaggtcattaaagttgttcaa
gaggaactgactgagctgatgggcggcgaagagagcaaaatcgccgtcgcaaaaaggccg
ccgactgttattatgatggtcggtctccaaggtgccggtaaaacgacaacaagcggtaag
cttgcgaatctgctgcgcaaaaagcataatcgcaaaccgatgctggttgctgccgatatt
taccgcccagccgcaattaagcagctggaaacactcggcaaacagcttgatatgcctgtt
ttctctcttggcgatcaggtcagtcctgtagaaatagctaaacaggctattgagaaagcc
aaggaagaacattatgactacgtcattttggatacggcagggcgcttgcatatcgaccat
gaactgatggatgaactgaccaacgtcaaagaaatcgcgaatccggaagaaattttcctg
gttgtcgattcaatgaccggtcaggacgctgtgaatgttgccaaaagctttaatgaacag
ctcggtttaaccggtgttgtgttgactaagctggatggagacacacgcggcggggctgcg
ctttctattcgcgctgtcacaaacacgccaattaagtttgcaggtttgggcgaaaagctt
gatgcgttagagccgttccatcctgaacgcatggcatcaaggattctcggcatgggcgac
gtgctgacattgattgaaaaagcacaggccagcgttgatgaagacaaagccaaagagctg
gaacaaaaaatgagaacgatgagcttcacattggacgattttctggagcagctcgggcaa
gtcagaaacatggggccgcttgatgagcttctgcaaatgatgccgggtgcaggtaaaatg
aagggcctgaaaaacatccaagttgatgaaaaacagctgaatcatgtggaagcaatcatc
aaatcaatgactgttcttgaaaaagaacagccggatattatcaatgccagccggcggaag
cggattgcaaaaggaagcgggacatccgtacaggaagtcaaccgtctgcttaagcagttt
gatgaaatgaaaaaaatgatgaagcagatgacaaacatgtcaaaaggcaagaaaaaaggg
tttaagctaccttttatgtaa

DBGET integrated database retrieval system