KEGG   Bacillus subtilis subsp. subtilis 168: BSU15990
Entry
BSU15990          CDS       T00010                                 

Gene name
rpsP
Definition
(RefSeq) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU15990 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU15990 (rpsP)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU15990 (rpsP)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU15990 (rpsP)
  Bacteria
    BSU15990 (rpsP)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU15990 (rpsP)
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-GeneID: 938059
NCBI-ProteinID: NP_389481
Pasteur: BG10831
BSORF: BG10831
UniProt: P21474 A0A6M3ZE91
Position
1673620..1673892
AA seq 90 aa
MAVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKIDEELALKWL
QTGAKPSDTVRNLFSSQGIMEKFHNAKQGK
NT seq 273 nt   +upstreamnt  +downstreamnt
atggcagtaaaaattcgtttaaaacgtatgggagcaaaaaaatctcctttctatcgtatt
gttgtagcagattctcgttcaccacgtgacggccgtttcatcgaaacagtcggaacttac
aacccggttgcaaaaccagcggaagtaaaaattgacgaagagcttgctcttaaatggctt
caaactggagcgaaaccatctgatacagttcgcaacttgttctctagccaaggaatcatg
gaaaaattccacaacgctaaacaaggcaagtaa

DBGET integrated database retrieval system