KEGG   Bacillus subtilis subsp. subtilis 168: BSU16020
Entry
BSU16020          CDS       T00010                                 

Symbol
rimM
Name
(RefSeq) ribosome maturation factor RimM
  KO
K02860  16S rRNA processing protein RimM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU16020 (rimM)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  ribosomal protein modification factors
   BSU16020 (rimM)
SSDB
Motif
Pfam: RimM PRC DUF3189
Other DBs
NCBI-GeneID: 935999
NCBI-ProteinID: NP_389484
Pasteur: BG13404
BSORF: BG13404
UniProt: O31740 A0A6M3ZBC8
Position
1674650..1675174
AA seq 174 aa
MTKRWFNVGKIVNTHGIKGEVRVISKTDFAEERYKPGNTLYLFMDGRNEPVEVTVNTHRL
HKQFHLLQFKERQNLNEVEELKNAIIKVPEEELGELNEGEFYFHEIIGCEVFTEEGELIG
KVKEILTPGANDVWVIGRKGKKDALIPYIESVVKHIDVREKKIEIELMEGLIDE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgacaaagcgatggtttaatgtaggcaaaatcgtaaatacccacggaatcaaaggcgaa
gtgcgggtgatttcaaaaacagattttgccgaagaacgatacaagccgggaaacacgctg
tatttgtttatggacggccgtaacgaaccagtggaggtaacggtaaacacacatagactg
cataagcaatttcatctcctgcagtttaaagaaagacaaaacctaaatgaagtagaagag
ctgaaaaacgcaatcattaaagttcctgaagaagaattaggagagctgaatgagggtgaa
ttttatttccacgaaattattgggtgtgaagtatttactgaagaaggcgaactcatcgga
aaggtcaaagaaattttgacgcctggagccaatgacgtttgggtcatcggacgaaaagga
aaaaaagacgcactcattccttacattgaatcagtggttaaacatatcgatgtcagggaa
aagaaaattgagattgaactcatggaagggttaatagacgaatga

DBGET integrated database retrieval system