KEGG   Bacillus subtilis subsp. subtilis 168: BSU16030
Entry
BSU16030          CDS       T00010                                 

Symbol
trmD
Name
(RefSeq) tRNA (guanine-N(1)-)-methyltransferase
  KO
K00554  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU16030 (trmD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     BSU16030 (trmD)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    BSU16030 (trmD)
SSDB
Motif
Pfam: tRNA_m1G_MT
Other DBs
NCBI-GeneID: 936650
NCBI-ProteinID: NP_389485
Pasteur: BG12687
BSORF: BG12687
UniProt: O31741 A0A6M4JGA6
Position
1675171..1675902
AA seq 243 aa
MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGM
VLKPQPVFDAVEDLTSKAAAAPRIILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDE
RIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHIEDSFSTGLLEHPH
YTRPADYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLLKDHPLTEQQRKWISEW
EKE
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaaatcgattttttgacgctgtttcccgaaatgtttgaaggcgtgctcggctcatcg
attcttcaaaaagcccaggaaaaagatgcggtgcagtttcaagtcgtaaatttccgagag
tactctgataacaagcacaatactgttgatgattatccttatggcggcggggcaggcatg
gttctcaagccccagcctgtttttgacgcggtcgaggacctgacatcaaaggcagccgct
gctccgcgtattatcctcgtatgcccgcaaggtgagcgttttacccaaaaaaaagccgaa
caattagctaaggaagagcatttgctgttcatttgcggccactatgaaggctatgatgaa
cgcattcgcgagcacttggtaacggatgaaatatcaattggcgactttgttctgacgggc
ggtgagctccctgcaatgatgatcgcagacagtgtggtcagactgcttccgggtgtactg
ggtaaagaggcttcccatattgaggattccttcagcaccggacttttagagcacccgcat
tatacaagaccggcagattacaaaggtttaaaagtgcctgaaacactcttgtcaggaaac
catgcaaaaattgaagaatggcggaataaagaatcgatcagaaggacctacctaagacgt
ccggatctgttgaaagaccacccgcttacagagcagcaaagaaagtggatttctgaatgg
gaaaaagaatag

DBGET integrated database retrieval system