KEGG   Bacillus subtilis subsp. subtilis 168: BSU16060Help
Entry
BSU16060          CDS       T00010                                 

Gene name
rnhB
Definition
(RefSeq) ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU16060 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU16060 (rnhB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     BSU16060 (rnhB)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     BSU16060 (rnhB)
   Elongation factors (archaeal)
     BSU16060 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-GeneID: 940133
NCBI-ProteinID: NP_389488
Pasteur: BG12666
BSORF: BG12666
UniProt: O31744
Position
1677451..1678218
Genome map
AA seq 255 aa AA seqDB search
MNTLTVKDIKDRLQEVKDAQDPFIAQCENDPRKSVQTLVEQWLKKQAKEKALKEQWVNMT
SYERLARNKGFRLIAGVDEVGRGPLAGPVVASAVILPEECEILGLTDSKKLSEKKREEYY
ELIMKEALAVGIGIVEATVIDEINIYEASKMAMVKAIQDLSDTPDYLLVDAMTLPLDTAQ
ASIIKGDAKSVSIAAGACIAKVTRDRMMSAYAETYPMYGFEKNKGYGTKEHLEALAAYGP
TELHRKTFAPVQSFR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattaaccgtaaaggacattaaagaccgtttgcaggaagtgaaggatgcacaa
gacccatttattgcccaatgcgaaaacgacccgagaaaaagcgttcaaacgcttgtagag
caatggcttaaaaagcaagcgaaagaaaaagcgctgaaagaacaatgggtgaatatgact
tcctatgaaaggctggcaagaaacaaaggatttcgcttgattgcaggtgttgacgaggtc
ggccgggggccattggcaggaccagttgtcgccagcgcagtcatccttccagaggaatgt
gaaatacttgggctgacagactccaaaaagctttcagagaaaaaacgcgaggaatattac
gagcttattatgaaggaagcactggcggtcgggataggaattgtagaagctactgtgatt
gatgagatcaatatatatgaagcttcaaaaatggcaatggtgaaagcgatacaggatttg
tcggatacacctgattatttgcttgttgacgcaatgacacttccgctcgacacggctcag
gcgtcaattataaaaggcgatgccaaaagcgtgtctattgcggcaggtgcgtgtatcgca
aaagtgacgagggaccgaatgatgagcgcttatgccgaaacgtatcccatgtacggcttt
gaaaaaaataaaggctatgggacaaaagaacatttggaagctctcgctgcatacggccca
actgaattgcaccgcaaaactttcgctcctgttcaatctttcagataa

DBGET integrated database retrieval system