KEGG   Bacillus subtilis subsp. subtilis 168: BSU16070
Entry
BSU16070          CDS       T00010                                 

Gene name
ylqG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: MFP2b
Other DBs
NCBI-GeneID: 936698
NCBI-ProteinID: NP_389489
Pasteur: BG13406
BSORF: BG13406
UniProt: O31745 A0A6M4JIL6
Position
1678250..1679980
AA seq 576 aa
MNIRNDVQKALQHLFGRTAVPQETSKVNEALNGEKRLLLGKVLRLLGDQHALIQVGNQTV
QGKLETQLRPQAYYWFSYEKKTAEQTGRLQVVQSFDQNPKTIQDAAGKLLNAISVKTSNA
ALMMTGAMLKSKTPVTENDIKTAVRWMDTLPSQDTKKAVETVLFALKRDLPIHSEILNGV
HAVKSPVPLHQHVSQLLQAIDQNPQQSQMMSKLKEAVTVLLNSEIDVHAERLIDKLISLT
DNTKAPSPTNTAGSRELSTPAGSPGKASLPIANHTAEQGSIQEEPVKTAADIPIKEARQL
LVKLTESAEKNSLQIVKEAANWIKAAASSGDSKSLAASAVLQAAQVTDQEAEVFLKAVQQ
TAPHLADKADVLSFLSKVKTAIGARDEVAFIKAFEQGSAVTSGEMQSIKLALSALRASHE
VAEPVKQEADQLFHKLNGQLFMQQDHPSYSQIVMSFPMFSKSGVQDMTVLFKGKKEADGK
LDPSHCRLLFLLQLDTLKETVVDCLVQQKVMTITIETDFELQAAIDPMVPALKQGLKEMG
YSLSGVNAKKRVHTEEKASIDQYITSISDQEVDVKI
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaacatacgaaatgatgtgcaaaaggcgctgcagcaccttttcgggcgtacagccgtc
ccgcaggaaacatcaaaagtaaacgaagcgctaaacggggagaagcgtctcctcttagga
aaagtgcttcgtttactaggagatcagcatgccctgatccaagtcggcaatcaaactgtt
cagggaaaacttgaaactcagcttcgtcctcaggcatactattggttttcctacgaaaaa
aaaacggcagagcaaacaggccgtcttcaggtcgttcaaagctttgatcaaaatcctaaa
accattcaggatgcagctggcaaacttttaaatgctatttcagtgaagacgtcaaacgca
gctctcatgatgacaggagcgatgctgaaaagcaaaacacccgtaacagaaaatgatatc
aaaacagctgtccgctggatggacacgctgccttcgcaagacacaaaaaaagcagttgaa
acggttctcttcgctttaaagcgtgatcttcccattcactccgagattttgaatggtgtt
cacgctgtgaaatcgcctgttccgttgcatcagcacgtatcccagctgctacaggcaatc
gaccaaaaccctcagcagagccaaatgatgtcaaagctaaaggaagcagtcacggtgctt
ttaaatagtgaaatcgatgtccatgcagaacggctgattgataagcttatttctttaacc
gacaatacgaaagcaccttctccgacgaatacagctggaagcagggagcttagcacacca
gctggctcccccggaaaagccagcctgccgattgcaaatcacacagcagaacagggaagc
atacaagaagagcctgttaaaacagcagcagacattccaattaaagaagcccgccagctg
ctggtgaagctgacggaatctgctgaaaaaaacagtctccaaattgtgaaagaagcagca
aattggattaaagcggctgcttcatcgggtgatagtaagtcacttgcagcttcagctgtt
ttacaggcggcacaagtcacagatcaggaagccgaagtctttttaaaggctgttcagcag
acagcaccccatttggcggataaggcagatgttctttctttcttatccaaagtgaaaacg
gcaatcggcgcaagggacgaggttgcgttcattaaagcgtttgaacaaggaagcgcagtc
acatctggcgaaatgcaatccatcaagctggctctttctgccttaagagcatcgcatgag
gtagccgaaccagtcaaacaagaagccgatcagctttttcataaattaaatggccagctt
ttcatgcagcaggaccatccatcatacagccaaattgtaatgtcatttccgatgttttcg
aagtcaggggttcaggacatgactgttctgtttaaaggaaagaaagaagcggatggaaag
cttgatccttcccattgccgccttttgtttttgctgcagcttgatacactaaaagaaacc
gtcgttgattgcttggtacagcaaaaagtcatgaccattacaatagagactgatttcgag
ctgcaggctgcgatcgatccgatggtgcccgcgcttaaacaggggctaaaggaaatgggg
tacagcctttcaggggtaaacgctaaaaaaagggttcacaccgaagaaaaggcttcaatc
gatcaatatataacaagtatcagtgatcaggaagtggatgtgaaaatatga

DBGET integrated database retrieval system