KEGG   Bacillus subtilis subsp. subtilis 168: BSU16090
Entry
BSU16090          CDS       T00010                                 

Symbol
sucC
Name
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00640  Propanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU16090 (sucC)
   00640 Propanoate metabolism
    BSU16090 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BSU16090 (sucC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BSU16090 (sucC)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Other DBs
NCBI-GeneID: 938521
NCBI-ProteinID: NP_389491
Pasteur: BG12680
BSORF: BG12680
UniProt: P80886 A0A6M4JJZ3
Position
1680431..1681588
AA seq 385 aa
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYIGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacatcggtctagtgcttgaccgcgccacttcaaga
atcgttttaatggcttctgaagaaggcggaacggaaattgaagaggttgcggagaaaaca
ccagaaaaaatcaaaaaagctgtcattgatccagctgttggccttcaaggctatcaagcc
agagaaattgcattcgctattaatattccaaaagagctcgtgggaaaagctgctaaattt
atgcttggactatataaagcgtttgttgagaaagactgctcaatcgccgaaatcaatccg
cttgttgtgactggcgacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtaccgacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaattgaagcgtccaaatatgatctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtctacgatggatattatcaagcattatgga
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgcggaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system