KEGG   Bacillus subtilis subsp. subtilis 168: BSU16100Help
Entry
BSU16100          CDS       T00010                                 

Gene name
sucD
Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00640  Propanoate metabolism
bsu00660  C5-Branched dibasic acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU16100 (sucD)
   00640 Propanoate metabolism
    BSU16100 (sucD)
   00660 C5-Branched dibasic acid metabolism
    BSU16100 (sucD)
Enzymes [BR:bsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BSU16100 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 937797
NCBI-ProteinID: NP_389492
Pasteur: BG12681
BSORF: BG12681
UniProt: P80865
Position
1681617..1682519
Genome map
AA seq 300 aa AA seqDB search
MSVFINKDTRVIVQGITGSTALFHTKQMLEYGTNIVGGVTPGKGGTEAEGVPVFNTVAEA
VQTTGANASVIYVPAPFAADAIMEAVDAELDLVICITEHIPVLDMVKVKRFMEGKKTRLI
GPNCPGVITPEECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLSEAGVGQSTAVGIGG
DPVNGTNFIDVLKAFNEDPDTHAVIMIGEIGGTAEEEAAEWVKANMTKPVVGFIGGKTAP
PGKRMGHAGAIISGGKGTADEKIKTLNACGIEVAETPSVMGETLIKVLKEKNLFETCKTH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttcattaataaagatacaagagttattgtgcaagggattacaggttctacc
gctttatttcatacgaagcagatgcttgaatacggcacaaatatcgttggcggtgtaaca
cctggaaaaggcggaacagaagcggaaggtgttcctgtatttaatacagtggctgaagca
gttcaaacaaccggcgctaacgcgtctgttatatatgtgcccgcaccgtttgcagctgat
gcgattatggaagcggtagatgcggagcttgatctcgtgatttgtatcacagaacatatc
ccggttttggatatggtgaaggtcaaacgcttcatggaaggcaagaaaacgagactgata
gggccgaactgtcctggtgtcattacgcctgaagaatgtaaaatcggcattatgcccgga
tacatccataaaaagggtcatgtaggcgttgtatcacgttcaggaacattaacatacgaa
gcggtgcaccagctctcagaagcgggtgtagggcaatctacagctgttggaatcggcggc
gaccctgtaaatggaacaaactttattgacgttttaaaagcgtttaacgaagatcctgac
acacacgcagtcatcatgattggcgaaatcggcggtacggccgaagaggaagcggcagag
tgggtaaaagccaacatgacaaaaccggtagtcggttttattggcggtaaaacagcacct
cctgggaagcgcatggggcatgcaggcgccattatttccggcgggaaagggacagctgat
gaaaaaatcaaaacccttaatgcatgcggaatcgaagttgcagagacaccttctgtcatg
ggtgaaaccttaatcaaggtgctgaaagagaagaacttgttcgaaacttgtaaaacgcat
taa

DBGET integrated database retrieval system