KEGG   Bacillus subtilis subsp. subtilis 168: BSU16120
Entry
BSU16120          CDS       T00010                                 

Symbol
topA
Name
(RefSeq) DNA topoisomerase 1
  KO
K03168  DNA topoisomerase I [EC:5.6.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU16120 (topA)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU16120 (topA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     BSU16120 (topA)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Topoisomerases
   BSU16120 (topA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      BSU16120 (topA)
SSDB
Motif
Pfam: Topoisom_bac zf-C4_Topoisom Toprim RNA_POL_M_15KD Toprim_4 Toprim_2 Toprim_3 JHBP
Other DBs
NCBI-GeneID: 937982
NCBI-ProteinID: NP_389494
Pasteur: BG11007
BSORF: BG11007
UniProt: P39814 A0A6M4JLU8
Position
1683661..1685736
AA seq 691 aa
MSDYLVIVESPAKAKTIERYLGKKYKVKASMGHVRDLPKSQMGVDIEQNFEPKYITIRGK
GPVLKELKTAAKKAKKVYLAADPDREGEAIAWHLAHSLDLDLNSDCRVVFNEITKDAIKE
SFKHPRMINMDLVDAQQARRILDRLVGYKISPILWKKVKKGLSAGRVQSVALRLIIDREK
EINDFKPEEYWTIDGTFLKGQETFEASFFGKNGKKLPLNSEADVKEILSQLKGNQYTVEK
VTKKERKRNPALPFTTSTLQQEAARKLNFRAKKTMMIAQQLYEGIDLGREGTVGLITYMR
TDSTRISNTAVDEAAAFIDQTYGKEFLGGKRKPAKKNENAQDAHEAIRPTSVLRKPSELK
AVLGRDQMRLYKLIWERFVASQMAPAVLDTMSVDLTNNGLTFRANGSKVKFSGFMKVYVE
GKDDQMEEKDRMLPDLQEGDTVLSKDIEPEQHFTQPPPRYTEARLVKTLEERGIGRPSTY
APTLDTIQRRGYVALDNKRFVPTELGQIVLDLIMEFFPEIINVEFTAKMERDLDHVEEGN
TEWVKIIDNFYTDFEKRVKKAESEMKEVEIEPEYAGEDCELCSSPMVYKMGRYGKFLACS
NFPDCRNTKPIVKQIGVKCPSCGEGNIVERKSKKKRVFYGCDRYPDCEFVSWDKPIERKC
PKCGKMLVEKKLKKGIQVQCVECDYKEEPQK
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgtctgattatctagtcatcgtggaatcgcccgctaaggcgaaaacgattgaacgttac
ttaggtaaaaaatataaagtaaaagcatcaatgggacatgtccgggatcttccaaaaagt
caaatgggagttgacatagaacagaattttgaaccgaaatatattaccattcgaggtaaa
ggcccggtattaaaagagctgaaaacggctgcgaaaaaagccaaaaaagtgtatctcgca
gctgaccccgacagagaaggggaagcgattgcatggcatttggcacacagtcttgattta
gatctcaactcagactgccgtgtggtgtttaacgaaattacaaaagacgctattaaggaa
tcgtttaagcatccccgcatgatcaatatggatttagtggatgcacagcaagcgagacgt
attttagacaggcttgtcggatataaaatcagtccaatcttatggaaaaaagtcaaaaaa
gggcttagcgcaggacgcgtgcaatccgttgccctccgtttgattattgaccgtgaaaaa
gagattaacgactttaagcctgaggaatattggacaattgacggtacgttcttaaaaggt
caagaaacctttgaagcgagctttttcgggaaaaacggcaaaaaacttcctttaaatagt
gaagctgatgtaaaagagattctttctcagctcaaagggaatcaatatacagttgaaaaa
gtaaccaaaaaggaacgcaaacgtaatcctgctttgccttttaccacttctaccctgcag
caggaagcggctcgcaagctcaatttcagagcgaagaaaacgatgatgattgcacagcaa
ttatatgaaggaattgatttaggaagagaaggaacggttggtctgatcacgtatatgaga
acggattcaacccgtatttcaaatacggctgttgatgaagcagctgcatttattgatcag
acatatggaaaagagttcctaggcggaaaacggaagcctgcgaaaaagaatgaaaatgcc
caggatgcccacgaagcaattcggccgacatcagttcttagaaaaccaagtgaattaaaa
gcagtcctcggcagagaccaaatgagactgtataaattaatttgggagcgttttgttgcc
agccaaatggcaccggctgttctcgatacaatgagtgtcgacctgacaaacaacggtttg
acatttcgtgcaaatggaagtaaagtcaagttttccgggtttatgaaggtgtatgttgaa
ggaaaagacgatcaaatggaagaaaaagaccggatgctgcctgacttacaagaaggcgac
acggtattatcaaaagatatagaacctgagcagcattttacccagccgcctccgcgatat
actgaggcccggcttgttaaaacccttgaagaacgcggtatcggccgtccatccacatat
gctccgacacttgatactattcagcggcgcggctacgtggcattggataataaacgtttc
gttccgactgaattaggtcagatcgttcttgacttgatcatggagtttttccctgagatc
attaacgttgagtttacagctaaaatggagagagatcttgatcatgttgaagaaggaaat
accgaatgggtcaagattatcgataatttctacaccgattttgaaaaacgcgtcaaaaaa
gccgaatcggaaatgaaggaagttgagattgaaccagagtatgctggagaggattgtgaa
ttgtgcagttctccaatggtatataaaatgggacggtacggtaaattcttagcttgctcc
aacttccctgactgccggaacacgaaaccgattgtgaaacaaatcggtgtgaagtgcccg
agctgcggagaaggaaacattgttgagcgaaaatcgaaaaagaaacgggtgttttacggc
tgtgaccgttatccggactgtgaattcgtatcatgggacaaaccaattgaacgaaaatgc
ccgaaatgcggaaaaatgctcgtcgagaaaaaactcaaaaaaggtatacaagtccaatgc
gtggaatgcgattataaggaagaaccacagaagtag

DBGET integrated database retrieval system