KEGG   Bacillus subtilis subsp. subtilis 168: BSU16140
Entry
BSU16140          CDS       T00010                                 

Gene name
xerC
Definition
(RefSeq) tyrosine recombinase XerC
  KO
K03733  integrase/recombinase XerC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU16140 (xerC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU16140 (xerC)
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 Phage_int_SAM_5 Acetyltransf_11
Other DBs
NCBI-GeneID: 938003
NCBI-ProteinID: NP_389496
Pasteur: BG10965
BSORF: BG10965
UniProt: P39776 A0A6M3ZAZ8
Position
1687187..1688101
AA seq 304 aa
MENVKNFVKLFVEYLQIEKNYSQYTIVNYVDSIEEFETFLRVQGINGFEEAAYQDTRIFL
TEAYEKGLSRRTISKKISALRSFYKFLMREKLIEENPFQLVHLPKQEKRIPKFLYQKELE
ELFEVSDISQPAGMRDQALLELLYATGMRVSECCSITINDVDLFMDTVLVHGKGKKQRYI
PFGSYAREALKVYMNSGRQCLLMKAKEPHDLLFVNQRGGPLTARGIRHILSGLVQKASST
LHIHPHMLRHTFATHLLNEGADLRSVQELLGHSNLSSTQIYTHVSKEMLRNTYMSHHPRA
FKKN
NT seq 915 nt   +upstreamnt  +downstreamnt
atggagaatgttaagaatttcgtaaagttattcgttgaatatttacaaattgaaaaaaat
tattcacaatatactattgtgaattatgtggattcaattgaagaattcgagactttcctg
cgcgttcaaggtataaatggatttgaagaagctgcatatcaagatactaggatttttttg
acagaagcctatgaaaaaggtttatcgagaagaacaataagcaaaaagatatctgcatta
agaagcttttataagtttctgatgcgggaaaagcttattgaagaaaatccgtttcagctt
gttcatctgccaaaacaggagaaacggataccgaagtttctatatcaaaaagagcttgag
gagctgtttgaagtttcagatataagccagccggccggaatgagggatcaagcgctgtta
gagctgctctatgccactggaatgagggtcagtgaatgctgttccataactattaacgac
gttgatttatttatggacactgtgcttgttcacggtaaaggcaagaagcagcgctatatc
ccctttgggtcttatgcccgcgaagcgttgaaggtatacatgaatagcggaagacagtgc
ttgctgatgaaggcaaaagaacctcatgatctattattcgtaaatcaaagaggcggaccg
cttacagcccgtggcatcagacatattttaagcgggcttgttcaaaaagcgtcaagcact
ttacatatccatccgcatatgcttcgacatacgttcgccacgcatctgttaaatgaagga
gcggatttgagaagcgttcaagaactgctcgggcattccaatctgtcttctacacagata
tacacgcacgtttcgaaggaaatgttgagaaacacatatatgtctcaccatccaagagca
tttaagaaaaattaa

DBGET integrated database retrieval system