KEGG   Bacillus subtilis subsp. subtilis 168: BSU16150
Entry
BSU16150          CDS       T00010                                 

Symbol
clpQ
Name
(RefSeq) ATP-dependent protease subunit ClpQ
  KO
K01419  ATP-dependent HslUV protease, peptidase subunit HslV [EC:3.4.25.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU16150 (clpQ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.2  HslU---HslV peptidase
     BSU16150 (clpQ)
Peptidases and inhibitors [BR:bsu01002]
 Threonine peptidases
  Family T1: proteasome family
   BSU16150 (clpQ)
SSDB
Motif
Pfam: Proteasome Peripla_BP_4
Other DBs
NCBI-GeneID: 938111
NCBI-ProteinID: NP_389497
Pasteur: BG10966
BSORF: BG10966
UniProt: P39070 A0A6M3ZAR8
Structure
PDB: 
2Z3B 2Z3A 1YYF

Position
1688114..1688659
AA seq 181 aa
MSSFHATTIFAVQHKGRSAMSGDGQVTFGQAVVMKHTARKVRKLFNGKVLAGFAGSVADA
FTLFEKFEAKLEEYNGNLKRAAVELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVI
EPDDGILAIGSGGNYALAAGRALKKHAGESMSASEIARAALETAGEICVYTNDQIILEEL
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgtcatcttttcatgcgaccacaatatttgccgtacagcataaaggacgaagcgctatg
tccggagacggccaagtaacatttggtcaggctgttgtcatgaaacacacggcacggaaa
gtgagaaaactgtttaacggcaaagttcttgctggttttgcgggatctgttgcagacgct
ttcactttattcgaaaagtttgaagctaagcttgaagaatataacggcaacttaaaacgg
gcggctgttgagcttgcaaaggaatggcgcagtgataaagtgctaagaaagctcgaagcc
atgctgattgttatgaatcaggatactttgcttctcgtatcgggaacaggcgaggtgatc
gaaccagatgacggcattctcgcgattggatcaggaggcaattacgctttggcagcggga
agagcactgaaaaagcatgccggggaaagcatgtctgcaagtgagattgccagagccgcg
ttagaaacagcaggcgaaatttgtgtttacacgaacgatcaaatcatactggaagagctt
gaatag

DBGET integrated database retrieval system