KEGG   Bacillus subtilis subsp. subtilis 168: BSU16170
Entry
BSU16170          CDS       T00010                                 

Symbol
codY
Name
(RefSeq) GTP-sensing transcriptional pleiotropic repressor CodY
  KO
K03706  transcriptional pleiotropic repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU16170 (codY)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    BSU16170 (codY)
SSDB
Motif
Pfam: CodY HTH_CodY HTH_11 HTH_Crp_2 Rrf2 GntR MarR_2 HTH_24 MarR TrmB HTH_20 HTH_5 Ribosomal_S25 HTH_41 HTH_27 GAF GAF_2 HTH_46 sCache_like HTH_36 RPA_C
Other DBs
NCBI-GeneID: 936491
NCBI-ProteinID: NP_389499
Pasteur: BG10968
BSORF: BG10968
UniProt: P39779 A0A6M4JIM3
Structure
PDB: 

Position
1690119..1690898
AA seq 259 aa
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIEND
RMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGG
ERLGTLILSRLQDQFNDDDLILAEYGATVVGMEILREKAEEIEEEARSKAVVQMAISSLS
YSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNNKFLIELENLKSH
NT seq 780 nt   +upstreamnt  +downstreamnt
atggctttattacaaaaaacaagaattattaactccatgctgcaagctgcggcagggaaa
ccggtaaacttcaaggaaatggcggagacgctgcgggatgtaattgattccaatattttc
gttgtaagccgcagagggaaactccttgggtattcaattaaccagcaaattgaaaatgat
cgtatgaaaaaaatgcttgaggatcgtcaattccctgaagaatatacgaaaaatctgttt
aatgtccctgaaacatcttctaacttggatattaatagtgaatatactgctttccctgtt
gagaacagagacctgtttcaagctggtttaacaacaattgtgccgatcatcggaggcggg
gaaagattaggaacacttattctttcgcgtttacaagatcaattcaatgacgatgactta
attctagctgaatacggcgcaacagttgtcggaatggaaatcctaagagaaaaagcagaa
gaaattgaagaggaagcaagaagcaaagctgtcgtacaaatggctatcagctcgctttct
tacagtgagcttgaagcaattgagcacatttttgaggagcttgacggaaatgaaggtctt
cttgttgcaagtaaaattgctgaccgtgtcggcattacccgttctgttattgtgaacgca
ctcagaaagctggagagcgccggtgttatcgagtctagatcattaggaatgaaaggtact
tatatcaaggtactaaacaacaaattcctaattgaattagaaaatctaaaatctcattaa

DBGET integrated database retrieval system