KEGG   Bacillus subtilis subsp. subtilis 168: BSU16180
Entry
BSU16180          CDS       T00010                                 

Symbol
flgB
Name
(RefSeq) flagellar basal body rod protein FlgB
  KO
K02387  flagellar basal-body rod protein FlgB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16180 (flgB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16180 (flgB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod and hook
    BSU16180 (flgB)
SSDB
Motif
Pfam: Flg_bb_rod Flg_bbr_C
Other DBs
NCBI-GeneID: 938149
NCBI-ProteinID: NP_389500
Pasteur: BG10237
BSORF: BG10237
UniProt: P24500 A0A6M3ZAT0
Position
1691278..1691667
AA seq 129 aa
MSLFSGTIQNLENALSRADIKQKVITNNIANIDTPNYKAKKVSFQNLLDQESSRLEAIKT
DYRHVDFSDTDSNYSIVASGDTSYQQNGNNVDVDKEMTELAQNQINYQALVERMNGKFNS
LKTVLTGGK
NT seq 390 nt   +upstreamnt  +downstreamnt
ttgagcttattttctggaacgatacaaaatcttgaaaatgccttgagcagagcggatatt
aagcaaaaagtcataactaataatatcgccaatatagatacaccgaactataaggcaaaa
aaagtctctttccaaaatttattagatcaagaatcctcgcgtcttgaagcgataaaaaca
gactatcgtcatgttgatttttctgatactgattcgaattattcaattgttgcgagcgga
gatacatcgtatcagcaaaacggaaacaatgttgatgttgacaaagagatgacagaattg
gcgcaaaatcaaatcaactatcaagctttggttgaaagaatgaacggtaaatttaattcg
ctgaagaccgtattaacaggaggaaaatga

DBGET integrated database retrieval system