KEGG   Bacillus subtilis subsp. subtilis 168: BSU16200
Entry
BSU16200          CDS       T00010                                 

Symbol
fliE
Name
(RefSeq) flagellar hook-basal body complex protein FliE
  KO
K02408  flagellar hook-basal body complex protein FliE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16200 (fliE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16200 (fliE)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod and hook
    BSU16200 (fliE)
SSDB
Motif
Pfam: FliE FlgI
Other DBs
NCBI-GeneID: 939470
NCBI-ProteinID: NP_389502
Pasteur: BG10239
BSORF: BG10239
UniProt: P24502 A0A6M4JGP9
Position
1692130..1692450
AA seq 106 aa
MINAISPFQVQNTQNTQNATNQVNNSQKTDSSNQTSFSELLKNSISSLNESQVASDNMTN
ALAAGKDVNLDEVMIAAQKASISLTAATEFRNKAVEAYQEIMRMQM
NT seq 321 nt   +upstreamnt  +downstreamnt
gtgattaatgcaatttctccttttcaggttcaaaatactcaaaacactcaaaatgcaaca
aatcaagtaaacaatagccaaaaaacagattcttcaaatcaaacaagcttttcggagctt
ttaaaaaactctattagttcgttaaatgagtcccaagtagcttctgacaacatgactaat
gccttggctgcaggaaaagatgtaaatcttgatgaggtcatgatcgctgctcaaaaagct
agcatctctctaactgcagcaacagagttccgcaataaagctgtggaagcttatcaggag
attatgagaatgcaaatgtag

DBGET integrated database retrieval system