KEGG   Bacillus subtilis subsp. subtilis 168: BSU16250
Entry
BSU16250          CDS       T00010                                 

Gene name
fliJ
Definition
(RefSeq) flagellar FliJ protein
  KO
K02413  flagellar protein FliJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16250 (fliJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16250 (fliJ)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16250 (fliJ)
Motif
Pfam: FliJ BofC_C Fib_alpha Archease
Other DBs
NCBI-GeneID: 940137
NCBI-ProteinID: NP_389507
Pasteur: BG10245
BSORF: BG10245
UniProt: P20487 A0A6M4JI87
Position
1697196..1697639
AA seq 147 aa
MAYQFRFQKLLELKENEKDQSLSEYQQSVSEFENVAEKLYENMSKKELLEQNKEKKLKSG
MSVQEMRHYQQFVSNLDNTIYHYQKLVIMKRNQMNQKQEILTEKNIEVKKFEKMREKQFK
MFALEDKAAEMKEMDDISIKQFMIQGH
NT seq 444 nt   +upstreamnt  +downstreamnt
gtggcttatcaatttagattccaaaagctgctggaactaaaagaaaatgaaaaagaccaa
tccttatccgaatatcagcaatcagtttctgaatttgaaaacgttgctgaaaaattatat
gagaatatgagcaaaaaggaattgctggaacaaaataaggaaaagaaattaaaaagcggc
atgagtgtacaagaaatgaggcactaccaacaatttgtctcaaatcttgataatacgatc
tatcactatcaaaagcttgtcattatgaaaagaaatcaaatgaatcaaaaacaagaaatt
ttgacagagaaaaacattgaagtgaaaaagtttgaaaaaatgcgtgaaaaacagtttaaa
atgtttgctcttgaagataaagctgcagaaatgaaagaaatggacgatatttcgattaag
cagtttatgattcaaggccattag

DBGET integrated database retrieval system