KEGG   Bacillus subtilis subsp. subtilis 168: BSU16260
Entry
BSU16260          CDS       T00010                                 

Gene name
ylxF
Definition
(RefSeq) flagellar filament outer layer protein FlaA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: MgtE_N Spc29 HIP1_clath_bdg HrpB7 Fib_alpha IFT20 Csm1_N SlyX CENP-Q Fez1 FliG_N SAS4 FlaC_arch PA26 UPF0242 KxDL DivIC
Other DBs
NCBI-GeneID: 940140
NCBI-ProteinID: NP_389508
Pasteur: BG10246
BSORF: BG10246
UniProt: P23454 A0A6M3ZAS9
Position
1697651..1698265
AA seq 204 aa
MSGKKKESGKFRSVLLIIILPLMFLLIAGGIVLWAAGINVLKPIQDAAAKTPVLKELVPE
TENKKGAASSKDSSNTAALEKTIKDQKSEISILNKDLETSKSEIDRLNQKIRSLEKTAED
QKKSSEDHTEGSADSKASSENDKVISVYKSMDSGKAAKIIAQLKEQEALKILNGLSKKQL
ADILAKMTPEQAATYTEKIAASQE
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtccggcaaaaagaaagaatcaggtaagttccgttcggttttgcttatcattatcctc
ccgctgatgtttctattaatcgcaggggggattgttctttgggctgctggtatcaatgtc
ttaaagccgatacaggatgctgcggcaaaaacgccggttcttaaagaattggtccctgaa
accgaaaataaaaaaggcgcagcatcaagtaaggatagcagtaatacggcagctctggaa
aagaccattaaggatcaaaaaagtgaaatcagtatattgaataaagatttagaaacaagt
aaatcagaaatcgacaggctcaatcaaaagatccgttcacttgaaaagacggctgaggat
caaaaaaagtcatcagaagatcatactgaaggatcagcagactcgaaagcttcttctgaa
aatgacaaagtgatcagtgtgtacaaaagcatggacagcggaaaggctgctaaaattatt
gcccaattaaaggagcaagaagcactgaaaatattgaatggcctaagcaaaaagcagctt
gctgacatattggcgaaaatgactcctgagcaagcagcaacctatacagaaaaaattgct
gccagccaagaatag

DBGET integrated database retrieval system