KEGG   Bacillus subtilis subsp. subtilis 168: BSU16270
Entry
BSU16270          CDS       T00010                                 

Symbol
fliK
Name
(RefSeq) flagellar hook-length control protein
  KO
K02414  flagellar hook-length control protein FliK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16270 (fliK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16270 (fliK)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod and hook
    BSU16270 (fliK)
SSDB
Motif
Pfam: Flg_hook CsbD
Other DBs
NCBI-GeneID: 937494
NCBI-ProteinID: NP_389509
Pasteur: BG10247
BSORF: BG10247
UniProt: P23451 A0A6M4JIN9
Position
1698278..1699741
AA seq 487 aa
MKLLELAGPLLQTTTGSAAKNMKSSQGVFQNWLMSEAGLKELSEQGKGTPNSEDQLLADA
LKKIGEWLNASPEDQDKQNADLLQTLSKLTGKQLDANALQMLQNLLQAVESKMSGGTDQL
LTETEKIFSEAKTALSANDSASDINGALKSDKEQSNQENEVSEPAKELIYIQMFISQLVE
GNKLTDLGNGNEAHAIYQNGDQFLSALEKKGVSQQLIQDLKQQIFTKAESSSKLYSMTAS
ELKSFQSLMDQMSMLPQKGTKEWSLAESQLKAFLLSKSSESSQDFGKSVLTPLSQSSSSK
NASDVSGSIQPVDSKSGLQMLFSGYRGIGGVQTLDLQQMSSDIPNAETKTVADQVINAWK
QMKYTPFGRSTGSFTIRLNPEHLGFVTIKLTNENGMFQSKIIASSQSAKELLEQHLPQLK
QSLPNMAVQIDRFTLPVQSGDQPIYGQLADEQKQQQEGQRQQRQKKQSNDFGDLLDEVSM
VEMEEEE
NT seq 1464 nt   +upstreamnt  +downstreamnt
gtgaagctgcttgaattagccggacctttgctgcaaaccacaacgggttctgccgctaaa
aacatgaaaagtagccagggagtttttcaaaactggcttatgtctgaggctggattgaag
gaactttcagaacaaggaaagggaactcctaattctgaagatcagcttttagcagatgcg
cttaaaaagatcggtgaatggctaaatgcaagtcctgaagatcaagacaaacaaaatgcg
gatcttttgcaaacattaagcaaactgacagggaagcaattggatgcgaatgctctgcaa
atgttgcaaaatcttttgcaagcagttgaatcaaaaatgtcaggcgggacggatcaattg
ctcacagaaacggagaaaatcttttcagaagctaaaacggctctgagtgccaatgattct
gcttctgacattaatggagcactgaagtctgataaagagcaatcaaatcaggaaaatgaa
gtatccgagcctgcaaaagagcttatctatatccagatgttcattagccagctcgtagaa
gggaataagctgactgatctcgggaatggcaatgaagctcatgccatttaccaaaatgga
gatcaattcctttctgcattagaaaagaagggtgtatctcaacaactaattcaggatctt
aaacagcaaatattcactaaagctgagtcaagttcaaaactttactcgatgacagcgtca
gagctgaaaagttttcaaagcttaatggatcaaatgtctatgcttcctcaaaaagggacc
aaagaatggagtttagctgaaagccagctgaaagccttcttgttatcgaaatcatccgaa
tcatcacaagactttgggaagagtgttctcacaccgctctcgcagagttcatccagcaaa
aatgcatcggatgtttctggaagtattcagcctgtagatagtaaatcaggactccaaatg
ctgttttcggggtatcggggcataggaggagttcaaacacttgatctgcagcagatgtca
tctgatataccaaatgccgaaacaaaaacggtggctgatcaagtgattaatgcgtggaag
cagatgaaatatacgcctttcggcagatcgacgggaagtttcactattcggctgaaccct
gaacatttaggatttgtcacaatcaagctgacaaatgaaaatggaatgtttcagagtaaa
atcatagcatctagccaatcagcaaaagaattgcttgaacagcatcttcctcagctgaag
caatcattgccgaatatggccgtccaaattgaccgttttactcttccggtccaaagcggg
gatcagccgatatacggccagcttgctgatgaacagaaacagcagcaagaggggcagaga
cagcaaagacagaaaaagcaatcaaatgattttggcgatctgctcgatgaagtgtcgatg
gttgaaatggaggaagaagaatga

DBGET integrated database retrieval system