KEGG   Bacillus subtilis subsp. subtilis 168: BSU16280
Entry
BSU16280          CDS       T00010                                 

Symbol
flgD
Name
(RefSeq) basal-body rod modification protein FlgD
  KO
K02389  flagellar basal-body rod modification protein FlgD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16280 (flgD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16280 (flgD)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod and hook
    BSU16280 (flgD)
SSDB
Motif
Pfam: FlgD DUF5104 DUF2220 VPS9
Other DBs
NCBI-GeneID: 936501
NCBI-ProteinID: NP_389510
Pasteur: BG10248
BSORF: BG10248
UniProt: P23455 A0A6M3ZAP7
Position
1699738..1700160
AA seq 140 aa
MTSISSEYKLPEKTNTVSTNNSSLGKDEFLKILMTQVQNQDPLNPIDDKEFISQMATFSS
LEQMMNLNTTMTQFVENQDPFTTYVDWMGKEVSWTDGKSATDKTGTVSSVKHFKGNYYLV
LDDGTEISPANVMSVGQSSK
NT seq 423 nt   +upstreamnt  +downstreamnt
atgacttctataagttcagaatataaactgcctgaaaaaacgaacactgtgtcgacgaac
aacagcagcttggggaaagacgagtttttaaaaatattaatgactcaagttcaaaaccaa
gatccgcttaacccgattgacgataaagaatttatcagccagatggcgactttttcaagc
ttggagcaaatgatgaatctgaatacgacaatgactcaattcgttgaaaaccaagatccg
tttacaacgtatgttgattggatgggaaaagaagtatcttggactgatggtaaaagtgca
acagataaaacaggcacagtaagctctgttaaacattttaaaggaaattattatctcgtt
cttgatgatgggaccgagatcagtcctgcgaatgtcatgtctgtgggacaatcatctaaa
taa

DBGET integrated database retrieval system