KEGG   Bacillus subtilis subsp. subtilis 168: BSU16290
Entry
BSU16290          CDS       T00010                                 

Symbol
flgG
Name
(RefSeq) flagellar basal-body rod protein FlgG
  KO
K02390  flagellar hook protein FlgE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16290 (flgG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16290 (flgG)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod and hook
    BSU16290 (flgG)
SSDB
Motif
Pfam: Flg_bbr_C Flg_bb_rod
Other DBs
NCBI-GeneID: 936497
NCBI-ProteinID: NP_389511
Pasteur: BG10249
BSORF: BG10249
UniProt: P23446 A0A6M4JK13
Position
1700182..1700976
AA seq 264 aa
MLRSLYSGISGMKNFQTKLDVIGNNIANVNTVGFKKSRVTFKDMVSQTIAGGSAAGATIG
GTNSKQIGLGSSSGTIDTIHSTSATQSTGRTLDLAIDGDGYFRIDTGDGTAYTRAGNFYL
DNTGTLVTGDGYHVLNMNGGTIKIPTDAQSFSIGSDGKVSIVDAEGKTQDGGQIGIVTFA
NSDGLDKIGSNLYRESLNSGTASAANQPGDGGTGALKSGFLEMSNVDLTDEFTEMIVAQR
GFQSNSKIITTSDEILQELVNLKR
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttacgttcactttattctggaatcagcggtatgaaaaactttcaaacaaagcttgac
gtaatcggtaacaacattgccaacgtaaatacagtaggattcaaaaagagccgtgtgacc
tttaaagatatggtaagccaaacgattgccggcggttctgctgctggtgcaacaatcggc
ggaacaaactctaagcaaatcggtttaggttcatcatctggcacaattgatacaattcat
tcaacaagcgcgacacaaagcacaggaagaacacttgatttagcaattgacggcgacggt
tacttccgaattgatacaggtgacgggacagcttatacaagagcagggaacttctattta
gataatactggaacactggttacaggtgatggctaccatgtactaaatatgaatggcgga
acaattaaaattcctactgatgctcaaagctttagcattggttctgatggaaaggtgtca
attgttgatgctgaggggaaaacacaagacgggggacaaatcgggattgttacttttgcc
aacagtgatggattggataaaatcggaagcaacctataccgtgaatctttaaactctgga
acggccagtgcagcgaaccagcctggtgacggcggaactggtgctcttaaatcaggattt
ctcgaaatgtctaacgtcgatttaactgacgaatttactgaaatgatcgtagcccagcgc
ggattccaatcaaactcaaaaattattacaacatctgatgaaatccttcaagaactggtt
aaccttaaacgttaa

DBGET integrated database retrieval system