KEGG   Bacillus subtilis subsp. subtilis 168: BSU16299
Entry
BSU16299          CDS       T00010                                 

Symbol
ylzI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FlbD Ribosomal_S22
Other DBs
NCBI-GeneID: 8303013
NCBI-ProteinID: YP_003097728
UniProt: C0H412 A0A6M4JGQ6
Position
1701016..1701231
AA seq 71 aa
MIKVTRLNGQPFTLNALFIEQIECFPDTTITLSNGKKFVVKEDEEAVLEKIAAFYRKIQI
FAMDQGIEEPE
NT seq 216 nt   +upstreamnt  +downstreamnt
atgattaaagtaacccgtttgaacgggcagccctttacactgaatgcgctatttattgaa
cagattgaatgttttccggatactacaattactctgtcaaatggtaagaagtttgtagta
aaagaagatgaagaagctgttctggaaaagatcgcagctttctaccgaaaaatacaaata
tttgcaatggatcaaggaatagaggaaccggaatga

DBGET integrated database retrieval system