KEGG   Bacillus subtilis subsp. subtilis 168: BSU16300
Entry
BSU16300          CDS       T00010                                 

Gene name
fliL
Definition
(RefSeq) flagellar protein FliL
  KO
K02415  flagellar protein FliL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16300 (fliL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16300 (fliL)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   M, S, P and L rings
    BSU16300 (fliL)
Motif
Pfam: FliL DUF2909 DUF4327 DUF4083 CcmE SAP_new25
Other DBs
NCBI-GeneID: 937103
NCBI-ProteinID: NP_389512
Pasteur: BG10250
BSORF: BG10250
UniProt: P23452 A0A6M3ZB41
Position
1701228..1701650
AA seq 140 aa
MKKKLMIILLIILIVIGALGAAAYFVLGGKSEKSEAKKSIDEIVASSVDVEEITTNLKSD
NIIRLAIKLETDSDKSKEELEKRDFQVKDAVISLLADTNADQIEGDKGKETFKKELKDKI
NSYLQEGKVEKVYITSFNLQ
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaagaaaaagttaatgatcatattactaattattcttatcgtaattggtgctctcggg
gcggcggcttattttgttttaggcggaaagtccgaaaaaagtgaagcgaaaaaaagtatt
gatgaaatcgttgcgtcttctgttgatgtagaagagatcacaacaaatttaaagtctgat
aacattatccgtcttgctattaaacttgaaactgattctgataaatcaaaagaagaactt
gagaaacgtgatttccaagtgaaagacgctgttatatcactgctggctgatacgaatgct
gatcagattgagggagacaagggaaaagaaacctttaagaaggaactaaaagataaaata
aatagctacctccaagaaggaaaagtagaaaaagtgtatattacctcctttaatctgcaa
taa

DBGET integrated database retrieval system