KEGG   Bacillus subtilis subsp. subtilis 168: BSU16330
Entry
BSU16330          CDS       T00010                                 

Gene name
cheY
Definition
(RefSeq) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU16330 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16330 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU16330 (cheY)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16330 (cheY)
Two-component system [BR:bsu02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   BSU16330 (cheY)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16330 (cheY)
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-GeneID: 940120
NCBI-ProteinID: NP_389515
Pasteur: BG10258
BSORF: BG10258
UniProt: P24072 A0A6M4JGE2
Position
1703834..1704196
AA seq 120 aa
MAHRILIVDDAAFMRMMIKDILVKNGFEVVAEAENGAQAVEKYKEHSPDLVTMDITMPEM
DGITALKEIKQIDAQARIIMCSAMGQQSMVIDAIQAGAKDFIVKPFQADRVLEAINKTLN
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcacatagaattttaattgtagatgacgcagcatttatgcgaatgatgattaaagat
attttggttaaaaatggttttgaagttgtggcggaagctgaaaatggagcacaagcggta
gagaaatataaagagcattcacctgaccttgttactatggatatcacgatgccagaaatg
gatggtattacagcattaaaagaaattaaacaaattgatgcgcaggcaagaatcatcatg
tgttctgctatgggacagcaatcaatggttattgatgccattcaggccggcgctaaggat
ttcattgtgaaacctttccaggctgaccgtgtgcttgaagcaatcaacaaaacattaaat
taa

DBGET integrated database retrieval system