KEGG   Bacillus subtilis subsp. subtilis 168: BSU16350
Entry
BSU16350          CDS       T00010                                 

Symbol
fliP
Name
(RefSeq) flagellar biosynthetic protein FliP
  KO
K02419  flagellar biosynthesis protein FliP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16350 (fliP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16350 (fliP)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16350 (fliP)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16350 (fliP)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16350 (fliP)
SSDB
Motif
Pfam: FliP
Other DBs
NCBI-GeneID: 940095
NCBI-ProteinID: NP_389517
Pasteur: BG10260
BSORF: BG10260
UniProt: P35528 A0A6M3ZB48
Position
1704863..1705528
AA seq 221 aa
MNEFINIFSSSDPENVSSTVKLLLLLTVFSVAPGILILMTCFTRIVIVLSFVRTSLATQS
MPPNQVLIGLALFLTFFIMAPTFSEINKEALTPLMDNKISLDEAYTKAEEPIKEFMSKHT
RQKDLALFMNYAKMDKPESLKDIPLTTMVPAFAISELKTAFQIGFMIFIPFLIIDMVVAS
VLMSMGMMMLPPVMISLPFKILLFVLVDGWYLIVKSLLQSF
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaatgagtttataaatattttcagttcaagcgatccggaaaacgtaagttcgactgtt
aaattactattattgttaactgtattttcagtggcgcctggaatattgattcttatgact
tgttttactcgcatcgtcattgttctgtcatttgtcagaacttcacttgcgacgcaatct
atgcccccaaaccaggttctaatcgggcttgcgctgtttttaacattttttattatggct
cctactttttcagaaattaataaagaagcgctgaccccattaatggacaacaaaatcagc
ttggatgaagcgtatacgaaagctgaggaaccgattaaagaatttatgagtaaacacaca
aggcagaaggatctggcgctgtttatgaattacgcgaaaatggataaacctgaatcatta
aaggatattccgttaacaacaatggttccggcttttgccatatcggagcttaaaacagca
tttcaaataggttttatgatttttatcccttttttaattatagatatggtagtggcgagc
gtcttgatgtcaatgggaatgatgatgctgcctccagttatgatttctctgccctttaaa
atattactttttgttttggtagacggctggtatttaattgtgaaatctttgcttcagagc
ttttag

DBGET integrated database retrieval system