KEGG   Bacillus subtilis subsp. subtilis 168: BSU16360
Entry
BSU16360          CDS       T00010                                 

Gene name
fliQ
Definition
(RefSeq) flagellar biosynthetic protein FliQ
  KO
K02420  flagellar biosynthesis protein FliQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16360 (fliQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16360 (fliQ)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16360 (fliQ)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16360 (fliQ)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16360 (fliQ)
Motif
Pfam: Bac_export_3 Ion_trans TM_helix DUF4282 DUF6526
Other DBs
NCBI-GeneID: 939623
NCBI-ProteinID: NP_389518
Pasteur: BG10261
BSORF: BG10261
UniProt: P35535 A0A6M4JIP6
Position
1705543..1705812
AA seq 89 aa
MSSEFVISMAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLL
ALIFFGPWMLSTILSFTTELFSNLNRFAG
NT seq 270 nt   +upstreamnt  +downstreamnt
gtgagttcagaatttgtaatttctatggcggaaaaagccgtatacgtaacgctgatgatc
agcgggccattattggctattgctttactggtcggtttaattgtcagcatatttcaggcg
acaactcaaatccaggaacagactttggcgtttattccgaaaatcgtggcggttctcctg
gctctcattttttttggtccgtggatgctgtcgacgattctttcatttacaacagagctg
ttttctaatttaaatcgttttgcagggtaa

DBGET integrated database retrieval system