KEGG   Bacillus subtilis subsp. subtilis 168: BSU16380
Entry
BSU16380          CDS       T00010                                 

Symbol
flhB
Name
(RefSeq) flagellar biosynthetic protein FlhB
  KO
K02401  flagellar biosynthesis protein FlhB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16380 (flhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16380 (flhB)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16380 (flhB)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16380 (flhB)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16380 (flhB)
SSDB
Motif
Pfam: Bac_export_2 DUF6404
Other DBs
NCBI-GeneID: 940128
NCBI-ProteinID: NP_389520
Pasteur: BG10543
BSORF: BG10543
UniProt: P35538 A0A6M4JK24
Position
1706599..1707681
AA seq 360 aa
MKLRVDLQFFAGEKTEKATPKKRKDTRKKGQVAKSSDVNTAVSLLVIFLSLIAIGPYMRD
RLLSFIETFYTESLTMKLSESNVHTLFVSLLKDMGMILAPILLVALVAGVVSNYMQVGFL
FSAEVIQPKLEKLDPIKGFKRIYSMRAIVELIKSILKIVVVGFAAFAVLWLHYGEILRLP
LLTPEEALSFVSKLTLWMGLSGAGALLILAGLDYLYQRFDYEKNIKMSKQDIKDEYKKSE
GDPIIKSKIKQRQREMAMRRMMQEVPKADVIITNPTHYAIALKYDEEKMDAPYIVAKGVD
HLALKIRKIAKEHDVMMVENRPLARALYDQVEIDQAVPEEFFKVLAEILAYVYKTKQKVY
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaagcttagagttgacctgcagttttttgcgggagagaagacagaaaaagccactccg
aaaaaacggaaggatacgcgaaaaaaagggcaggtagccaaaagctcggatgtcaatacc
gccgtttctttactggtaatattcctttcgcttattgcaattggtccgtatatgagagac
aggctgctgtcattcatagaaacattttataccgaatcgctcacaatgaagctctcagaa
tcaaatgtgcatacattgtttgtcagcttattaaaggatatgggcatgatactcgcaccg
atcttgcttgttgctcttgttgcaggagtcgtaagcaactatatgcaggttgggttcttg
ttttctgctgaagtgatacagcctaagcttgaaaaactggatccgatcaaaggctttaaa
cgaatatacagtatgagggcgattgtagagctgattaaatcaattttgaaaatcgtagtc
gtcggttttgcggcttttgctgtgctttggctgcattatggagaaattctccggcttcct
ctcctgacacccgaagaggcactttctttcgtttcaaaactcactttgtggatgggacta
agcggtgcaggtgcattgttgattcttgctggtctcgactatttatatcagagatttgac
tatgagaaaaatatcaaaatgtcaaaacaagatataaaagatgagtacaaaaaatctgaa
ggagacccgattatcaagtctaaaattaaacaaagacagcgggaaatggcgatgaggcgg
atgatgcaggaagttccaaaagcagatgtcattatcacaaacccgactcactatgcgatt
gctttgaaatatgatgaagaaaaaatggacgcaccttatattgttgcaaaaggcgtcgac
caccttgcgttaaaaatcaggaaaattgctaaagagcatgatgtcatgatggtagaaaac
agaccgcttgcccgtgcgttatatgatcaagtggaaattgaccaggcagtgccggaagaa
ttttttaaagttttagcagaaattctggcttacgtatataaaacaaaacaaaaagtatat
tga

DBGET integrated database retrieval system