KEGG   Bacillus subtilis subsp. subtilis 168: BSU16390
Entry
BSU16390          CDS       T00010                                 

Symbol
flhA
Name
(RefSeq) flagellar biosynthesis protein FlhA
  KO
K02400  flagellar biosynthesis protein FlhA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16390 (flhA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16390 (flhA)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16390 (flhA)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16390 (flhA)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16390 (flhA)
SSDB
Motif
Pfam: FHIPEP
Other DBs
NCBI-GeneID: 940029
NCBI-ProteinID: NP_389521
Pasteur: BG10542
BSORF: BG10542
UniProt: P35620 A0A6M4JGR4
Structure
PDB: 
3MIX

Position
1707714..1709747
AA seq 677 aa
MSTRDLSVLISVVLIVAMLVIPFPPWLLSILIIINISLALIVLLTTMNMQEALQFSIFPS
LLLLLTLFRLGLNVSTTRSILSHGEGGKVVETFGNFVVGGNVLVGLVVFIILIIIQFIVI
TKGAERVSEVAARFTLDAMPGKQMSIDADLNAGMITEQEAKHRREKVAREADFYGAMDGA
SKFVKGDAIAGIIIVMINIIFGIVIGMLQQGMSIQEAASHFTMLTVGDGIVSQIPALLIS
TATGIVVTRAASEGNLGHDITGQLFAYPKLLYVAAATIMLLGIFTPIGILLTGPLAGLLA
FGAYTLSKSGKEKEEVDEILEEEAEVDELKSPESVVQLLHIDPIEFEFGYGLIPLADANQ
GGDLLDRIVMIRRQLALELGLVIPVVRIRDNIALQPNEYRLKIKGNEVAKGELLLDHYLA
MSPTPEDDLIEGIETVEPSFGLPAKWISEAVKDEADMLGYTVVDPASVVSTHITEKIKQH
AHELIGRQETKQLIDHLKESYPVLVEEVTPNPLSVGDIQKVLAKLLKEKVSIRNLVTIFE
TLADYGKLTTDSDLLTEYTRQALAKQITAQFAKENEVLKVVTCSGRVEKAIADGVQQTEH
GNYLSLEPDISESIVRSVAKEAEQLSLRQETAILLCSPPVRMYVKQLLERYFPDLPVLSY
NELEANVEVQSIGVVDI
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgtcaacaagagatttatccgttttaataagtgttgtcctcattgtggcgatgctggtg
attccatttcctccatggctgttaagtattttgatcattattaatatttctcttgcgttg
atcgtgcttctcaccacaatgaatatgcaggaagcgcttcagttttcgatttttccgtca
ctgttgctgcttttgaccctatttcgtttgggcttgaacgtctcaactacccgttcaatt
ctttcacacggtgagggaggtaaagtcgtcgagactttcggaaatttcgttgtcggcgga
aatgtattagttggactcgttgtatttatcatccttattattattcagtttatcgtcatt
acaaaaggtgctgaacgtgtttccgaggttgcagcaaggtttacgctggacgcaatgccg
gggaagcagatgagtattgatgctgatttaaacgcagggatgattaccgaacaggaagcg
aagcatcgccgcgaaaaagtggcaagagaagcagacttttatggagcaatggacggtgcc
agtaaatttgtaaaaggtgacgccattgccggaatcatcattgtgatgatcaatattatt
ttcggaatcgtgatcggaatgcttcagcagggcatgtccattcaagaagctgcttcacac
tttacgatgctgactgtaggggatggaattgtttcgcaaatcccggcactgttaatttct
acggctacgggtattgtggtcacaagagctgcatctgaaggaaacttagggcatgacatt
acaggccagctgtttgcgtatccaaagcttttatacgtcgcagcagctacgatcatgctt
ttaggtattttcactccgatcggcatccttctgacggggccgcttgcgggattgcttgct
tttggcgcatatacactatctaaatcaggtaaggaaaaagaagaagtggatgagattctt
gaggaagaggctgaggtggacgagcttaaaagccctgaaagtgttgttcagcttctgcat
atagatccgatagaatttgagtttggatatggcctgataccgcttgctgatgccaatcaa
ggcggtgatttattagaccgaattgttatgatacgccgtcagttggctttggaactcggg
cttgtcattcctgtcgtgcgaatcagagataatatagcgttgcagcctaatgaataccga
ttgaaaattaaaggaaacgaagtagcaaaaggcgagctgttgcttgatcattatttagcg
atgtcgcctactcctgaggacgatctcattgaagggattgaaacagtggagccttcattc
ggactgccggctaaatggattagcgaagcggtaaaggatgaagccgacatgcttggttat
acagtagttgatcctgcatcagtcgtttcaacgcatattacggagaaaattaagcagcat
gcccacgaattgatcggaaggcaggagacaaaacagctgatcgatcacttgaaagaatcg
tatccagtcctggttgaagaggttacgccgaatccattgtctgtcggtgatattcagaaa
gtgcttgctaagcttttaaaagaaaaagtttcaattcgaaacttagtaacgatttttgaa
acacttgctgactatgggaaattaacaacagattctgatctcttgacagagtatacaaga
caagcgcttgctaaacaaattacagcccagtttgccaaagaaaatgaagtgttgaaggtt
gttacttgttccggccgtgtagaaaaagcaatagcagacggtgtgcagcagacggaacac
gggaactatttatcacttgaaccagatatttcagaaagtatagtgcgctctgtcgccaaa
gaagctgaacagctctcattacgtcaggaaaccgcgattcttctttgctcgccgcctgtc
agaatgtatgtgaagcagctactggaacggtacttccctgatcttccggtactctcttat
aacgaacttgaggcgaatgttgaggtacaaagcattggagtggtggatatttaa

DBGET integrated database retrieval system