KEGG   Bacillus subtilis subsp. subtilis 168: BSU16450
Entry
BSU16450          CDS       T00010                                 

Gene name
cheC
Definition
(RefSeq) Chey-P phosphatase CheC
  KO
K03410  chemotaxis protein CheC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16450 (cheC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16450 (cheC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16450 (cheC)
SSDB
Motif
Pfam: CheC CheX
Other DBs
NCBI-GeneID: 939621
NCBI-ProteinID: NP_389527
Pasteur: BG10749
BSORF: BG10749
UniProt: P40403
Position
1715344..1715973
AA seq 209 aa
MSIFNGIKEEQMDILREVGNIGAGHSASAMAQLLNRKIDMEVPFAKLLSFDELVDFFGGA
DVPVASIFLRMEGDLTGSMFFIMPFFQAEQFIRELIGNPDFDIEDLGEDHMSSSALHELG
NILAGSYLTALADLTKLQLYPSVPEVSLDMFGAVISEGLMELSQVGEHAIVVDTSIFDQS
HQQELKAHMFMLPDYDSFEKLFVALGASL
NT seq 630 nt   +upstreamnt  +downstreamnt
atgagtatttttaatggaatcaaagaagagcagatggacattttgcgggaagtcggcaat
ataggcgccggccactccgcctctgcaatggcccagctgttaaatagaaagatagatatg
gaagtcccatttgcaaagctgctgtcttttgatgagcttgttgattttttcggcggcgcc
gatgtcccggttgccagcatctttttaagaatggaaggcgatttaacgggttcaatgttc
tttataatgcctttttttcaggcggagcagtttatcagagagctgattggaaaccccgat
tttgacatagaggacttaggtgaagaccacatgagctcatccgctttgcatgaactgggc
aatattttagcggggtcatatttaacagctttggcggatttgacgaaactccagctctat
ccaagtgttcctgaagtctcattggacatgttcggagctgtgatcagcgaagggctgatg
gagctcagtcaggttggagaacacgccattgttgtcgacacgtcaatttttgaccaaagc
catcagcaggagctgaaagcgcatatgtttatgctgccggactatgattcatttgaaaag
ctctttgtcgccttaggtgcatcattatga

DBGET integrated database retrieval system