KEGG   Bacillus subtilis subsp. subtilis 168: BSU16460
Entry
BSU16460          CDS       T00010                                 

Symbol
cheD
Name
(RefSeq) chemoreceptor glutamine deamidase CheD
  KO
K03411  chemotaxis protein CheD [EC:3.5.1.44]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU16460 (cheD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16460 (cheD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     BSU16460 (cheD)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU16460 (cheD)
SSDB
Motif
Pfam: CheD
Other DBs
NCBI-GeneID: 939959
NCBI-ProteinID: NP_389528
Pasteur: BG10750
BSORF: BG10750
UniProt: P40404 A0A6M4JIQ3
Position
1715970..1716470
AA seq 166 aa
MSTTEAVVIKVGIADVKIARFPDTIRTSGLGSCVGLVLYDKEKQTAGLVHVMLPDSTLSK
TAELNRAKYADTAVQTTIDMLIEAGCRKFALKAKLAGGSEMFKFKSTNDLMKIGPRNVLA
IKEQLSLFNIPIISEDTGGSSGRTIEFEPKSCMLHIRTVKQGEKTI
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagtacaactgaggctgttgttataaaggttgggattgctgacgtgaagatcgcccgc
ttcccggataccatccggacctctggtttgggctcatgtgtggggctggtgctttatgat
aaagaaaagcaaacggcgggtcttgttcatgtcatgcttccggattcgacgttatcgaaa
actgccgagctcaaccgggctaagtacgctgacaccgccgtacagaccacgattgatatg
ctgatagaagcgggatgccggaaatttgcattaaaagcaaagctggccggcggatcagag
atgtttaaatttaaatcgacaaatgatttgatgaagatcggaccgagaaatgtattagcg
ataaaagaacagctgtctttatttaatattcctattattagtgaagatacgggcggctca
agcggccggacgatagaatttgaaccgaagtcctgcatgctgcatattcgaactgttaaa
caaggtgaaaaaacgatttaa

DBGET integrated database retrieval system