KEGG   Bacillus subtilis subsp. subtilis 168: BSU16480
Entry
BSU16480          CDS       T00010                                 

Symbol
ylxL
Name
(RefSeq) swarming motility protein SwrB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_7 Snu56_snRNP DUF6115 DUF4795 LapA_dom Terminase_5 Ribosomal_S13_N Sin3a_C IRK DUF2802 Chordopox_A13L Ly49 DUF2232
Other DBs
NCBI-GeneID: 939618
NCBI-ProteinID: NP_389530
Pasteur: BG10752
BSORF: BG10752
UniProt: P40405 A0A6M3ZAR9
Position
1717286..1717789
AA seq 167 aa
MSTLLWLLSFMLHGVLLYAVIILYTRLAAVKETEKQQKQILEETENTLAAFLLELKEENE
KLIENKASSASQSDEESQKSGLQTSETYQERDPVQEAENLPEHIEGLITEVDRREELVNS
EVQSFEDQVIELYEQGYSASQIAQKMKSGKTEIELFLKFRSKGVKDS
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcaacactattatggcttttaagctttatgctccacggcgttcttctgtacgctgtc
attatcctgtatacgaggctcgctgcagtgaaagaaacagaaaaacagcaaaaacagata
cttgaagagacggaaaacaccttggcggcatttctgcttgaattaaaagaagaaaatgag
aaactgatagaaaataaagcttcatctgcaagtcaatcagatgaagaatcccaaaagtca
ggccttcagacctctgaaacatatcaagagcgggatccagtccaagaggcagagaatctt
cctgaacatattgaaggtctgattacagaggttgaccgtcgggaagagctcgtaaacagt
gaggtccaatcatttgaagaccaggtcatagaattatatgaacagggatattcggcaagt
caaattgcccagaaaatgaagagcggaaagacagaaatcgagctatttttaaaatttcgc
tccaaaggtgtaaaggattcttga

DBGET integrated database retrieval system