KEGG   Bacillus subtilis subsp. subtilis 168: BSU16500
Entry
BSU16500          CDS       T00010                                 

Symbol
tsf
Name
(RefSeq) elongation factor Ts
  KO
K02357  elongation factor Ts
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU16500 (tsf)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU16500 (tsf)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Elongation factors
   BSU16500 (tsf)
 Prokaryotic type
   BSU16500 (tsf)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSU16500 (tsf)
SSDB
Motif
Pfam: EF_TS HOIP-UBA
Other DBs
NCBI-GeneID: 939601
NCBI-ProteinID: NP_389532
Pasteur: BG19025
BSORF: BG19025
UniProt: P80700 A0A6M3ZEE9
Position
1718775..1719656
AA seq 293 aa
MAITAQQVKELREKTGAGMMDCKKALTETDGDMDKAIDLLREKGIAKAAKKADRIAAEGS
TLIKTDGNKGVILEVNSETDFVAKNEGFKELLNTLADHLLANTPADVEEAMGQKMENGST
VEEYITSAVAKIGEKITLRRFTVLTKDDSSAFGAYLHMGGRIGVLTVLNGTTDEETAKDI
AMHVAAVNPRYISRDQVSEEETNHERQILTQQALQEGKPENIVAKMVEGRLNKFFEEICL
LDQAFVKNPDEKVKQVIAAKNATVQTFVRYEVGEGIEKRQENFAEEVMNQVKK
NT seq 882 nt   +upstreamnt  +downstreamnt
atggcaattactgcacagcaagtaaaagaactgcgtgaaaaaactggcgcgggcatgatg
gattgtaaaaaagcgttaactgaaactgacggagatatggacaaagcaattgacctttta
agagaaaaaggaattgcaaaagcagcgaaaaaagctgaccgtatcgcagcagaaggttct
actcttattaaaactgacggcaacaaaggcgttatcctagaagtaaactctgaaactgat
ttcgttgcgaaaaacgaaggttttaaagagcttcttaacactttagctgaccaccttctt
gcaaacacgccagctgatgttgaagaagcaatgggccaaaaaatggaaaatggctcaact
gttgaagagtacatcacaagcgcagttgctaaaatcggtgagaaaatcactcttcgccgc
tttacagttcttacaaaagacgacagctctgcattcggtgcgtaccttcacatgggcggc
cgcatcggtgtattaactgttctcaacggtacaactgatgaagaaactgcgaaagatatc
gcaatgcacgttgctgcagttaaccctcgttacatttctcgtgatcaagtatctgaagaa
gaaacaaatcatgagcgtcaaatcttaactcagcaagccctccaagaaggcaaacctgaa
aacatcgtagcgaaaatggttgaaggccgtctgaacaaattcttcgaagaaatttgtcta
ttagaccaagcgttcgttaaaaacccagatgaaaaagtgaaacaagttattgcagcgaaa
aacgctactgttcaaacttttgtccgctatgaagttggagaaggcatcgaaaaacgtcaa
gaaaactttgctgaagaagtaatgaaccaagtgaaaaaataa

DBGET integrated database retrieval system