KEGG   Bacillus subtilis subsp. subtilis 168: BSU16510
Entry
BSU16510          CDS       T00010                                 

Gene name
pyrH
Definition
(RefSeq) uridylate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU16510 (pyrH)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     BSU16510 (pyrH)
Motif
Pfam: AA_kinase
Other DBs
NCBI-GeneID: 939602
NCBI-ProteinID: NP_389533
Pasteur: BG12675
BSORF: BG12675
UniProt: O31749 A0A6M3ZB56
Position
1719802..1720524
AA seq 240 aa
MEKPKYKRIVLKLSGEALAGEQGNGINPTVIQSIAKQVKEIAELEVEVAVVVGGGNLWRG
KTGSDLGMDRATADYMGMLATVMNSLALQDSLETLGIQSRVQTSIEMRQVAEPYIRRKAI
RHLEKKRVVIFAAGTGNPYFSTDTTAALRAAEIEADVILMAKNNVDGVYNADPRKDESAV
KYESLSYLDVLKDGLEVMDSTASSLCMDNDIPLIVFSIMEEGNIKRAVIGESIGTIVRGK
NT seq 723 nt   +upstreamnt  +downstreamnt
atggaaaaaccaaaatacaaacgtatcgtattaaagcttagcggggaagcattggcagga
gaacagggaaatggaattaacccgactgtcattcaatccattgcaaagcaagtgaaggaa
atcgctgagcttgaagtcgaagtggctgttgttgtaggcggcggcaacttatggcgcgga
aaaacaggaagtgacctgggcatggaccgcgcgactgctgactatatgggaatgctggcg
acagtaatgaattcgcttgctcttcaagacagcttggaaacactcggaatccagtccaga
gtgcaaacatccattgaaatgagacaagttgctgaaccgtacataagaagaaaagcgata
cgccacttagagaaaaaacgtgtcgttattttcgctgcgggcacaggaaacccatatttc
tcaactgatacgacagctgcactgcgggctgctgaaattgaggcagacgttattttaatg
gctaaaaataacgttgacggtgtgtataatgctgatcctagaaaagatgaatcagctgtt
aagtatgaatcactttcttatcttgacgttcttaaagacggcctggaagtcatggattca
acagcttcctctttatgcatggacaatgacattccgcttatcgtcttttctattatggaa
gaaggaaatatcaaacgtgccgttatcggtgaatcaatcggaacgatcgtgagggggaaa
taa

DBGET integrated database retrieval system