KEGG   Bacillus subtilis subsp. subtilis 168: BSU16520
Entry
BSU16520          CDS       T00010                                 

Gene name
frr
Definition
(RefSeq) ribosome-recycling factor
  KO
K02838  ribosome recycling factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU16520 (frr)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Release factors
   BSU16520 (frr)
 Prokaryotic type
   BSU16520 (frr)
SSDB
Motif
Pfam: RRF Viral_P18 UPF0147 DUF3288 Sec20 MinE
Other DBs
NCBI-GeneID: 939605
NCBI-ProteinID: NP_389534
Pasteur: BG12587
BSORF: BG12587
UniProt: P81101
Position
1720526..1721083
AA seq 185 aa
MSKEVLTQTKEKMEKAIAAYQRELATVRAGRANPSLLDKVTVEYYGAQTPLNQLSSINVP
EARMLVITPYDKTAIGDIEKAILKADLGLTPTSDGNMIRIAIPALTEERRKELVKVVKKY
AEEAKVAVRNVRRDANDDLKKLEKNGDITEDELRASTEDVQKLTDEYVSKIDSVTKDKEK
EIMEV
NT seq 558 nt   +upstreamnt  +downstreamnt
gtgtcaaaagaagtattaactcaaacaaaagaaaaaatggaaaaagcaattgctgcttat
cagcgcgaattggctactgtacgcgcaggccgtgcaaatccatcattattagataaagta
acggttgaatattacggagcgcagacacctttaaatcagttgtcttctattaacgtgcct
gaagctcgtatgctcgttatcacgccatacgataaaacagcaatcggtgatatcgaaaaa
gcgattttaaaagctgatttaggtcttacaccaacaagtgacggcaatatgattcgaatt
gcaattccggcactaacagaagagagacggaaagaattagtgaaagttgtaaaaaaatat
gctgaagaagcaaaagtagctgttcgtaacgttcgccgtgatgctaacgatgatctcaaa
aaacttgagaaaaacggagacattactgaggatgaactgcgtgcttccactgaagacgtt
caaaaactgacagatgaatatgtgtcaaaaattgacagtgtcacaaaagacaaagaaaaa
gaaatcatggaagtttaa

DBGET integrated database retrieval system