KEGG   Bacillus subtilis subsp. subtilis 168: BSU16530
Entry
BSU16530          CDS       T00010                                 

Symbol
uppS
Name
(RefSeq) undecaprenyl pyrophosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu00900  Terpenoid backbone biosynthesis
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU16530 (uppS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU16530 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU16530 (uppS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     BSU16530 (uppS)
Prenyltransferases [BR:bsu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BSU16530 (uppS)
SSDB
Motif
Pfam: Prenyltransf fvmX2
Other DBs
NCBI-GeneID: 939640
NCBI-ProteinID: NP_389535
Pasteur: BG13408
BSORF: BG13408
UniProt: O31751 A0A6M3ZBH6
Position
1721214..1721996
AA seq 260 aa
MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEG
MKVVKRTTKLANELGVKVLTLYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQ
VRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYGGRTEIVSAAKSLAEKVKEGS
LNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKE
DHFLQALGEFQQRGRRFGGI
NT seq 783 nt   +upstreamnt  +downstreamnt
atgctcaacatactcaaaaattggaagaatcagcaaactgcggcttccaacttagaacgt
tatacaaaagaagacatacttaagggagaaattcccgaacacatcgccattatcatggat
ggaaatggccgttgggctaaaaaacgctctcttcccagaattgcaggccaccatgaaggg
atgaaggtggtaaaaaggaccacgaagctcgcaaacgaattaggtgtcaaagtactgaca
ttgtatgcattttcaacagaaaactggaaaagaccgaaaatggaggtcgattttttaatg
aagcttccggaagaatttttgaatacgtatcttccagagcttgttgaggaaaatgtacag
gttcggatcattggggatgaaacggctttgccggcgcacacattacgtgcgattgaaaaa
gctgtacaggacacggcgcaaaacgacggaatgatccttaattttgctcttaactatgga
ggccgtactgaaattgtcagtgctgcaaaatcactcgcggaaaaagtgaaggaaggctct
ttgaatattgaagacattgatgaatcgcttttttctacttatttgatgactgaatctttg
caggatcctgaacttttaattcgaacgagcggcgagataaggctgagtaattttatgcta
tggcaggttgcctacagtgaatttgtctttactgacgtcttgtggcctgactttaaagaa
gatcacttcttgcaggcgttaggagagtttcagcagagaggccggaggtttggcggaatt
tag

DBGET integrated database retrieval system