KEGG   Bacillus subtilis subsp. subtilis 168: BSU16540
Entry
BSU16540          CDS       T00010                                 

Symbol
cdsA
Name
(RefSeq) phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU16540 (cdsA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     BSU16540 (cdsA)
SSDB
Motif
Pfam: CTP_transf_1 DUF92 DUF3262
Other DBs
NCBI-GeneID: 939607
NCBI-ProteinID: NP_389536
Pasteur: BG12575
BSORF: BG12575
UniProt: O31752 A0A6M3ZB76
Position
1722000..1722809
AA seq 269 aa
MVDMKQRILTGVLAAIVFLFLVIVGKLPFTILIYAMGSVALFELLRMKKLKLVSLPGLIG
LLLLWMFLLPSQYSFFEADGISKMEIALFAVLLLLTYTVLVKNTFTFDEVGFITLAAIYI
GMCFHYFIEIRNLDQYGLTYIFYACVVIWSTDSGAYFVGKSLGKRKLWPEISPNKTVEGF
AGGIVIALVLATIFQLVAQLPIPYIYLLLITLFLSVFGQLGDLVESALKRHYDVKDSGNI
LPGHGGILDRFDSFLFVMPFLYFLLALFS
NT seq 810 nt   +upstreamnt  +downstreamnt
atggtggacatgaaacaaagaattttgacaggtgttctggcagcaattgtatttttattt
ttggttattgtcgggaaattgccgttcaccatattaatttatgctatgggcagtgtggcg
ctttttgaacttttacggatgaaaaagctgaagctggtttcactgccgggtttgatcggt
cttttattattgtggatgttcttattaccaagccagtattcgttttttgaagcggacggg
atttccaaaatggaaatcgctttatttgcggtactgctattgctgacttacacagtgttg
gtcaagaacacctttacttttgatgaagtcgggtttattacgcttgcagcaatttacatc
ggaatgtgttttcattattttatcgaaatcagaaatcttgaccaatacggattaacatac
attttttatgcgtgtgttgtcatttggtccaccgattccggtgcctattttgtcggtaaa
tcgcttgggaagcggaaactgtggcctgaaatcagtccgaataaaacagtggaagggttt
gcaggcggaattgtcatcgcacttgtattggcgacgatttttcagcttgttgcacaactt
ccgatcccgtatatctatctgctgttgatcacgctgtttttgtctgtttttggacaactg
ggagatttagtggaatccgccttgaaaagacattacgatgtaaaggattctgggaatatt
cttcccgggcatggcggtatattagaccgttttgacagtttcttgtttgtcatgcctttc
ttgtactttctgcttgcccttttttcataa

DBGET integrated database retrieval system