KEGG   Bacillus subtilis subsp. subtilis 168: BSU16550
Entry
BSU16550          CDS       T00010                                 

Symbol
dxr
Name
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00900  Terpenoid backbone biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSU16550 (dxr)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BSU16550 (dxr)
SSDB
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 939636
NCBI-ProteinID: NP_389537
Pasteur: BG13409
BSORF: BG13409
UniProt: O31753 A0A6M3ZB65
Position
1722871..1724022
AA seq 383 aa
MKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLD
TYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRD
KTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFEKAD
FDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQLLK
KPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt   +upstreamnt  +downstreamnt
ttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagactcttgatgta
ctgcgtgcacatcaagaccaatttcagctggtatctatgtcgtttggcagaaatattgat
aaggccgttccaatgattgaggtctttcagccgaagtttgtctctgtcggtgatctggat
acatatcataaattaaaacaaatgtctttttcttttgaatgccaaatcgggctgggagaa
gaaggactgatagaagcagcagtgatggaggaggttgacattgttgtcaacgctttgctt
ggaagcgtcggtcttatcccgacattaaaggcaattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgctaagaaatat
gatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagctcttcaaggc
gaacaggctaaaaacattgaacgcctcatcattacggcatccggcggaagttttcgggac
aagacgcgggaggagctcgaatcagtaacggttgaagatgcattaaaacatccaaactgg
tcaatgggtgcaaaaattacaattgattcggctacaatgatgaataagggattagaggtg
atcgaggcacactggcttttcgatataccttatgaacaaattgatgtggttttacataag
gagagcatcatccattcaatggttgagttccatgataaaagtgtgatcgcacagctcgga
actccggatatgagagtccccattcaatatgcgctcacttatcctgaccgattgccatta
ccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgagaaagctgat
tttgacaggttccgatgcttacaatttgcttttgaatcaggtaaaataggaggaacaatg
ccgacagtgctaaatgcggcaaacgaagtagctgtcgctgcctttttagctggcaagata
ccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaattactgaaa
aaaccgagcctggcggacattcaagaagtggacaaagatacccggggatacgtcaattca
atactcacataa

DBGET integrated database retrieval system