KEGG   Bacillus subtilis subsp. subtilis 168: BSU16560
Entry
BSU16560          CDS       T00010                                 

Symbol
rseP
Name
(RefSeq) zinc metalloprotease RasP
  KO
K11749  regulator of sigma E protease [EC:3.4.24.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU16560 (rseP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BSU16560 (rseP)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M50: S2P protease family
   BSU16560 (rseP)
SSDB
Motif
Pfam: Peptidase_M50 PDZ_6 PDZ_2 PDZ Tricorn_PDZ
Other DBs
NCBI-GeneID: 939612
NCBI-ProteinID: NP_389538
Pasteur: BG13410
BSORF: BG13410
UniProt: O31754 A0A6M4JIR2
Position
1724029..1725297
AA seq 422 aa
MFVNTVIAFIIIFGTLVFFHELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETVYTIRL
LPVGGFVRMAGEDPEMIEVKPGYTVGLLFNKEDQVEKVIINQKEKYPDALVIEVETADLE
HDMKITGYEQGKEDELSSFTVSETSFFIVDGEEVQIAPYNRQFGSKPVWQRIKAIAAGPI
MNFILAYVILVMLGLIQGVPSNEPMLGQLTDNGRAAEAGLKEGDYIQSINGEKMRSWTDI
VSAVKENPEKEMDVAVKRDNKTLHISVTPEAVKDENKKTIGRFGSYAPTEKGVLSAVAYG
ATSTVDVTKAILTNLSKLVTGQFKLDMLSGPVGIYDMTDQVAKTGIVNLFQFAAFLSINL
GIVNLLPIPALDGGRLLFLFIEAIRGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRL
FL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgttcgtgaatacagttatagcgtttatcattattttcggaacgctcgttttcttccat
gaactgggccatttattgctagcccaaagagcgggaattctctgccgtgaatttgcgatc
ggcttcggtccaaagattttttctttcaaaaaaaatgaaacagtttatacgatcaggctg
cttccggtcggcggatttgttcgtatggccggcgaagatccggaaatgattgaggtgaaa
cccggatacacggtcgggcttctgtttaataaggaagatcaagttgagaaagtcatcatc
aatcaaaaggaaaaatatccggatgctttagtcattgaagtggaaacagcggatctagag
catgacatgaagatcaccggttatgaacaggggaaagaggacgaactttccagctttact
gtcagcgaaacatccttttttattgtagacggagaagaagtgcagattgcgccgtataat
cgccaatttggttccaaacctgtatggcagcggattaaagcaattgctgcagggccgatt
atgaactttattttagcttacgtcattttagtgatgcttgggctgattcaaggcgtaccg
tcaaatgaacctatgctcgggcagctgacagacaatggacgggcggctgaagcagggcta
aaagaaggggattatatccaaagcattaacggagagaaaatgaggtcttggactgacatt
gtctccgctgtaaaagaaaacccggagaaagaaatggacgttgcagtaaaaagagataac
aaaacgcttcatatttcggtgactccggaagctgttaaagatgagaacaaaaaaacaatc
ggacgtttcggttcctatgcgccgactgaaaaaggcgtactctcagcggttgcttacggc
gcgacatcaacagttgatgtcaccaaagccattttaaccaatctgagcaaattagtaaca
ggccaatttaaactcgatatgctgtcaggtcctgtcggcatatatgacatgacagaccaa
gtggcgaaaacagggatcgtgaacttatttcagtttgcggcgtttttaagcattaacctt
gggattgtcaacctgcttccgattccggcacttgacggaggaagactgttgtttctattt
attgaagcgattcggggcaaaccgattaacagggaaaaagaagcatttgttgtgtttatc
ggagtagctttcttaatgcttcttatgctggttgtcacatggaacgatatccagcggctg
tttttgtaa

DBGET integrated database retrieval system