KEGG   Bacillus subtilis subsp. subtilis 168: BSU16570
Entry
BSU16570          CDS       T00010                                 

Gene name
proS
Definition
(RefSeq) proline--tRNA ligase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU16570 (proS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU16570 (proS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU16570 (proS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     BSU16570 (proS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BSU16570 (proS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSU16570 (proS)
 Prokaryotic type
    BSU16570 (proS)
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon MecA Imm21
Other DBs
NCBI-GeneID: 939617
NCBI-ProteinID: NP_389539
Pasteur: BG12659
BSORF: BG12659
UniProt: O31755 A0A6M4JI95
Position
1725330..1727024
AA seq 564 aa
MRQSLTLIPTLREVPADAEAKSHQLLLRAGFIRQNTSGVYSYMPLAYKVIQNIQQIVREE
MEKIDAVEMLMPALQQAETWQESGRWYTYGPELMRLKDRHGREFALGATHEEVITSLVRD
EVKSYKRLPLTLYQIQSKFRDEKRPRFGLLRGREFIMKDAYSFHASAESLDETYQKMYEA
YSNIFARCGINVRPVIADSGAMGGKDTHEFMALSAIGEDTIAYSDESQYAANIEMAEVLH
QEVPSDEEPKALEKVHTPNVKTIEELTAFLQVSAEACIKSVLFKADDRFVLVLVRGDHEV
NDIKVKNLLHAEVVELATHEEVIQQLGTEPGFVGPVGIHQDVEVYADQAVKAMVNAVAGA
NEGDHHYKNVNVNRDAQIKEFADLRFIKEGDPSPDGKGTIRFAEGIEVGQVFKLGTRYSE
AMNATYLDENGRAQPMLMGCYGIGVSRTLSAIAEQHHDEKGLIWPKSVAPYDLHILALNM
KNDGQRELAEKLYADLKAEGYEVLYDDRAERAGVKFADSDLIGLPIRITVGKRADEGIVE
VKIRQTGESTEISVDELSAFISKQ
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgagacaaagcttgacgcttattcctacgctccgtgaagttccagctgatgccgaagca
aaaagtcatcagcttcttctgagagcaggatttatcagacagaatacgagcggggtatac
agctatatgcctcttgcgtataaggtgattcaaaacattcagcagattgttcgagaggaa
atggagaaaattgatgccgtagaaatgctcatgcccgcattgcagcaggcagagacatgg
caggaatcaggcagatggtatacgtatggtcccgaactgatgagactaaaagaccgtcat
ggccgtgaatttgctttaggggcaacgcatgaagaggttatcacttcgcttgttcgcgat
gaggttaaatcttataagcgtctccctctgactctttatcaaattcagtctaagttcaga
gatgaaaaacgtcctcgcttcggtttgttaagaggccgcgaatttattatgaaggatgcg
tactctttccatgcatctgcagagagcctggatgaaacgtatcaaaaaatgtacgaggcc
tattctaatatttttgcccgctgcggcattaatgtaagacctgttatcgctgattcaggc
gcaatgggaggaaaggatacgcacgaatttatggcactttctgcgatcggagaggatacg
attgcgtattctgatgaatcacagtacgcggctaatatcgagatggctgaagttcttcac
caggaagttccttcagatgaagagcctaaagctctagagaaggttcatacgcctaacgtg
aaaacaatcgaagaactgactgcgttcttacaggtttcggctgaagcgtgcattaagtca
gtattgtttaaagctgatgaccgttttgtcttagtgcttgtaagaggggatcatgaagtt
aacgatattaaagtgaaaaacttgcttcatgcagaagttgtagagcttgctacacatgaa
gaggtcattcagcagctcggaacagagccaggctttgtaggccctgtcggtattcatcag
gatgtggaagtatatgccgatcaagctgtgaaagcaatggttaatgctgttgccggggca
aatgaaggagatcatcattataaaaatgtcaatgtgaatcgtgacgcgcaaattaaagaa
tttgctgatcttcgttttattaaagaaggtgatccttcaccagacggcaagggaacgatc
cgttttgctgagggaatcgaagtcggacaagtctttaagctcggaacacgctattcagaa
gcgatgaatgcgacatatttagatgaaaacggacgcgcgcagccaatgctgatgggctgt
tacggaatcggtgtgtcaagaacgctttctgctattgctgaacagcatcacgacgaaaaa
ggcttaatatggccaaaaagcgttgcgccgtacgatcttcatattcttgctttgaacatg
aaaaacgatgggcaaagagagcttgctgaaaagctgtatgccgatttaaaagcggaaggc
tatgaagtgctctatgatgaccgtgctgagcgtgccggcgtaaaattcgctgattcagat
ttaatcggccttccaatccgcatcactgtcggaaaacgagctgacgaaggaatcgtcgaa
gtgaaaattcgtcaaactggtgagtcaactgagatttcagtagacgaattatctgcgttt
atcagcaagcagtaa

DBGET integrated database retrieval system