KEGG   Bacillus subtilis subsp. subtilis 168: BSU16580
Entry
BSU16580          CDS       T00010                                 

Gene name
polC
Definition
(RefSeq) DNA polymerase III PolC-type
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03030  DNA replication
bsu03430  Mismatch repair
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BSU16580 (polC)
   03430 Mismatch repair
    BSU16580 (polC)
   03440 Homologous recombination
    BSU16580 (polC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU16580 (polC)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU16580 (polC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BSU16580 (polC)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BSU16580 (polC)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     BSU16580 (polC)
Motif
Pfam: DNA_pol3_alpha PHP RNase_T DNA_pol3_a_NII DNA_pol3_finger DNA_pol3_a_NI HHH_6 DUF5051 HHH_3 tRNA_anti-codon RNase_H_2 Zn-ribbon_8 DZR
Other DBs
NCBI-GeneID: 939620
NCBI-ProteinID: NP_389540
Pasteur: BG10263
BSORF: BG10263
UniProt: P13267 A0A6M3ZAS8
Position
1727133..1731446
AA seq 1437 aa
MEQLSVNRRQFQILLQQINMTDDTFMTYFEHGEIKKLTIHKASKSWHFHFQFKSLLPFQI
YDTLTTRLTQSFAHIAKVTSSIEVQDAEVSESIVQDYWSRCIEELQGISPPIISLLNQQK
PKLKGNKLIVKTKTDTEAAALKNKYSSMIQAEYRQFGFPDLQLDAEIFVSEQEVQKFREQ
KLAEDQERAMQALIEMEKKDKESDEDQAPSGPLVIGYQIKDNEEIRTLDSIMDEERRITV
QGYVFDVETRELKSGRTLCIFKITDYTNSILIKMFAREKEDAALMKSLKKGMWVKARGSI
QNDTFVRDLVMIANDVNEIKAKTREDSAPEGEKRVELHLHSPMSQMDAVTGIGKLVEQAK
KWGHEAIALTDHAVVQSFPDAYSAAKKHGIKMIYGMEANLVDDGVPIAYNAAHRLLEEET
YVVFDVETTGLSAVYDTIIELAAVKVKGGEIIDKFEAFANPHRPLSATIIELTGITDDML
QDAPDVVDVIRDFREWIGDDILVAHNASFDMGFLNVAYKKLLEVEKAKNPVIDTLELGRF
LYPEFKNHRLNTLCKKFDIELTQHHRAIYDTEATAYLLLKMLKDAAEKGIQYHDELNENM
GQSNAYQRSRPYHATLLAVNSTGLKNLFKLVSLSHIHYFYRVPRIPRSQLEKYREGLLIG
SACDRGEVFEGMMQKSPEEVEDIASFYDYLEVQPPEVYRHLLELELVRDEKALKEIIANI
TKLGEKLNKPVVATGNVHYLNDEDKIYRKILISSQGGANPLNRHELPKVHFRTTDEMLEA
FSFLGEEKAKEIVVTNTQKVASLVDDIKPIKDDLYTPKIEGADEEIREMSYQRARSIYGE
ELPEIVEARIEKELKSIIGHGFAVIYLISHKLVKRSLDDGYLVGSRGSVGSSLVATLTEI
TEVNPLPPHYVCPECQHSEFFNDGSVGSGFDLPDKTCPHCGTPLKKDGHDIPFETFLGFK
GDKVPDIDLNFSGEYQPQAHNYTKVLFGEDNVYRAGTIGTVAEKTAYGYVKGYAGDNNLH
MRGAEIDRLVQGCTGVKRTTGQHPGGIIVVPDYMDIYDFSPIQFPADATGSEWKTTHFDF
HSIHDNLLKLDILGHDDPTVIRMLQDLSGIDPKTIPTDDPEVMKIFQGTESLGVTEEQIG
CKTGTLGIPEFGTRFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIHNNICELS
EVIGCRDDIMVYLIYQGLEPSLAFKIMEFVRKGKGLTPEWEEEMKNNNVPDWYIDSCKKI
KYMFPKAHAAAYVLMAVRIAYFKVHHALLYYAAYFTVRADDFDIDTMIKGSTAIRAVMED
INAKGLDASPKEKNLLTVLELALEMCERGYSFQKVDLYRSSATEFIIDGNSLIPPFNSIP
GLGTNAALNIVKAREEGEFLSKEDLQKRGKVSKTILEYLDRHGCLESLPDQNQLSLF
NT seq 4314 nt   +upstreamnt  +downstreamnt
atggaacagttatcagtaaacagaaggcagtttcaaattcttctgcagcagattaatatg
acagatgataccttcatgacatactttgaacatggcgagattaaaaagctgacaattcac
aaagcttctaagtcttggcattttcattttcaatttaaatctttgctgccttttcaaata
tatgacacattaacaacgaggctgacgcaatcgtttgcccacatagcaaaagtgacatct
tcaattgaagttcaggatgccgaggtcagtgaaagtatcgttcaagactactggtcacgc
tgcattgaagaactgcagggcatttcgccgccgattatcagtcttttaaaccagcaaaaa
ccgaagctgaagggcaataaactgattgtcaaaaccaaaacagatacagaagcggctgcg
ctaaagaacaaatacagttccatgattcaagcagaataccgtcaatttggctttccggat
cttcagcttgatgctgaaatatttgtatccgagcaagaagttcaaaagtttcgggagcaa
aagcttgcggaagaccaagagcgggctatgcaggccttgattgaaatggagaagaaagat
aaagaaagtgatgaagaccaagcaccatctggtcctcttgttatcggttatcaaattaaa
gataacgaggaaatccgaacacttgacagcatcatggacgaagaacggagaattacggtc
caaggttatgtgtttgatgtggagacgcgcgagctgaagagcgggcgcacgctgtgtatc
ttcaaaattacagactatacaaatagtattttgatcaaaatgtttgcacgtgaaaaagaa
gatgcggcgctgatgaagtctctgaaaaaaggaatgtgggtaaaagcacgcggaagcatt
caaaatgatacatttgtcagagaccttgtcatgatcgcaaatgacgtaaacgaaataaaa
gcaaaaacccgtgaagattcagcacctgaaggagaaaaaagagtggaattgcatcttcat
tccccaatgagccaaatggatgctgttacgggtatcggaaagcttgtcgaacaggcgaaa
aaatgggggcatgaggccatcgctttgaccgaccatgctgtcgttcaatccttccctgat
gcgtattctgcggccaaaaagcatggaattaaaatgatttacgggatggaagcgaatctc
gtggatgatggcgtgccaattgcttataatgccgcacatcgtctgctcgaagaagaaaca
tatgttgtttttgacgttgagacgacaggattgtctgctgtatacgataccattattgag
ctggctgcagtaaaagtaaaaggcggagaaattattgataaatttgaggcgtttgcgaac
ccgcatcgtccgctttccgccacaatcatagagctgacagggatcacagatgatatgcta
caagacgctccggatgtcgtagatgtaataagagatttcagagaatggattggcgatgat
attcttgtcgctcataatgcaagctttgatatgggattcttaaatgtagcctataaaaaa
cttcttgaagtcgaaaaagctaaaaacccagtcattgatacgcttgaacttggacgtttt
ctctatccggaatttaagaaccaccggttgaacacactttgtaaaaagtttgatatcgag
ctcacacagcatcaccgtgcgatctatgatactgaggcaaccgcttatttgcttctgaaa
atgctgaaagacgcagctgaaaaaggtattcagtaccatgatgagttgaatgaaaatatg
ggtcagtccaatgcttatcaaagatcaagaccgtatcatgcaacattacttgccgtgaac
agcacgggacttaaaaatttatttaagcttgtgtcactttctcatattcattatttttac
agagtgccgcgtattccgagatctcagcttgagaaatacagggaagggcttctgatcggt
tctgcttgtgacaggggagaggtttttgagggaatgatgcaaaaatcgcctgaagaggtg
gaagatatcgcgtcattctatgattaccttgaggttcagccgcctgaagtgtatcgtcac
ttgctggagcttgaactggtccgtgatgaaaaagcgctgaaagaaattattgcgaatatc
acgaagctgggggaaaagcttaataaaccggttgttgctacgggaaatgttcattacttg
aatgatgaggataaaatctacagaaagattttaatatcctcacaaggcggggcaaatccg
ctgaataggcatgaactgccgaaagtgcatttcagaacgacagacgaaatgcttgaagct
ttttctttcttaggtgaagaaaaagcgaaggagatcgtagtcaccaatacccaaaaggtt
gcttctttagttgatgacatcaagccgattaaagatgatttatatacgccgaaaatcgaa
ggcgctgatgaagagatcagagaaatgagctatcagcgtgcaagaagcatttacggggaa
gagctgcctgaaattgtcgaagcgcggattgaaaaagagttaaagagtattattggccac
ggatttgctgttatttacttgatctctcacaaacttgtaaaacgttcactagatgacggg
tatctcgttggttcccgtggttccgtaggatcttcattagttgcgacacttactgagatt
actgaggtaaacccgctgccgccgcactatgtttgtcctgagtgccagcattctgagttc
tttaatgacggttctgtcggttctggttttgacctgcctgacaagacatgccctcattgc
ggaacgcctttgaaaaaagacggccatgatattccatttgaaacgttcttaggatttaaa
ggggacaaagtacctgatatcgatttgaacttctcaggggaatatcagccgcaagcacac
aattacacaaaagtattgttcggagaagacaatgtatatcgtgcgggaacaataggcacg
gtggcagaaaaaacagcctacggttatgtaaaaggctatgccggagacaacaatcttcat
atgcgcggtgccgaaatagatcggctcgtacagggatgcacaggtgtaaaacgtacaact
ggacagcaccctggcggtattatcgtagttccggattatatggatatttatgatttttca
ccgatccagttcccggcagatgccacaggttcagagtggaaaacgactcattttgatttc
cactccatccatgacaacctgttaaaacttgatattctcggacacgatgacccgactgtt
attcggatgcttcaagacttaagcggaatagatccgaaaacaattccgacggatgatcct
gaagtgatgaagatcttccagggaaccgaatcactcggtgtgactgaagaacagattggc
tgtaaaacgggcactcttggaattcctgaattcggaacccgatttgtccggcagatgctt
gaagatacaaagccgaccactttttctgagctcgttcagatttcaggcttgtctcacgga
actgatgtatggcttggcaatgcacaggagctcatccacaataatatttgtgagctgagt
gaggttatcggctgccgtgatgacattatggtttatttaatctatcaaggccttgagccg
tcccttgcctttaaaatcatggaattcgtgcgtaaaggaaaaggattaacgcctgaatgg
gaagaagaaatgaaaaataacaatgtcccagactggtatattgattcctgtaaaaagatt
aaatacatgttcccgaaagcccacgccgcggcatatgtcttaatggcagtccgcattgct
tactttaaagtgcatcatgctcttttgtattatgcggcttattttaccgttcgtgcagat
gactttgatattgatacaatgatcaagggctctacagcaatcagagcggtaatggaggat
ataaacgctaaaggacttgatgcttcaccgaaggaaaagaaccttctgactgttttagaa
ttagcgcttgagatgtgtgagagaggctattcattccaaaaagtcgatttatatcgctcc
agcgccacagagtttattattgacggcaacagtcttattccgccgtttaactctattcca
gggttagggacgaacgctgctttgaacattgtaaaagctcgcgaagaaggcgaattcctc
tcaaaagaagatttgcaaaagagagggaaagtatcaaaaacgattttagagtacttagat
cgccatggctgtctggagtcactgcctgatcaaaaccaattgtcactgttctaa

DBGET integrated database retrieval system