KEGG   Bacillus subtilis subsp. subtilis 168: BSU16590
Entry
BSU16590          CDS       T00010                                 

Symbol
ylxS
Name
(RefSeq) ribosome maturation factor RimP
  KO
K09748  ribosome maturation factor RimP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU16590 (ylxS)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU16590 (ylxS)
SSDB
Motif
Pfam: DUF150 DUF150_C DUF211
Other DBs
NCBI-GeneID: 939625
NCBI-ProteinID: NP_389541
Pasteur: BG10264
BSORF: BG10264
UniProt: P32726 A0A6M4JGT3
Position
1731776..1732246
AA seq 156 aa
MSKKVTDTVQEMAQPIVDSLQLELVDIEFVKEGQSWFLRVFIDSDDGVDIEECAKVSEAL
SEKLDEADPISQNYFLEVSSPGAERPLKKKADFEKSLGKNVYIKTYEPIDGVKVFEGELA
EFDGQTVTVEITIKTRKKRINIPYEKIANARLAVTF
NT seq 471 nt   +upstreamnt  +downstreamnt
atgagcaaaaaagtgactgacaccgttcaagaaatggctcagccaatcgtagacagcctt
cagctggaactcgttgacattgaatttgtcaaagagggccaaagctggttccttcgcgtg
tttattgattccgatgacggtgtggatattgaggaatgtgccaaagtaagcgaagcttta
agcgaaaagcttgatgaggcagacccaatcagccaaaattactttcttgaagtctcatct
ccaggagctgagcgtccgctaaagaaaaaagccgatttcgaaaaatcactaggaaaaaac
gtatacattaagacgtatgagcctattgacggcgtaaaagtgtttgaaggtgaactggct
gaatttgatggacaaacagtgacagttgagatcacgatcaaaacaagaaagaaacggatc
aatattccgtatgaaaagatagctaatgcaagattagctgttacattctaa

DBGET integrated database retrieval system