KEGG   Bacillus subtilis subsp. subtilis 168: BSU16610
Entry
BSU16610          CDS       T00010                                 

Symbol
ylxR
Name
(RefSeq) hypothetical protein
  KO
K07742  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU16610 (ylxR)
SSDB
Motif
Pfam: YlxR
Other DBs
NCBI-GeneID: 939653
NCBI-ProteinID: NP_389543
Pasteur: BG10266
BSORF: BG10266
UniProt: P32728 A0A6M4JLZ5
Position
1733410..1733685
AA seq 91 aa
MNKHKKIPLRKCVVTGEMKPKKELIRVVRSKEGEISVDPTGKKNGRGAYLTLDKECILAA
KKKNTLQNQFQSQIDDQIFDELLELAEKVKK
NT seq 276 nt   +upstreamnt  +downstreamnt
gtgaataaacacaaaaagatcccattacgcaaatgtgtagtgactggtgaaatgaagcct
aaaaaggaactgatccgagttgtacggtcgaaagaaggcgaaatctcagtagacccgacc
ggaaaaaagaatgggcggggtgcttatttaacgctggataaagagtgcatcttagcagca
aaaaagaaaaacactttgcaaaatcaatttcaatcacaaatcgatgaccagattttcgat
gaattgctggaactggcggaaaaggtgaaaaaataa

DBGET integrated database retrieval system