KEGG   Bacillus subtilis subsp. subtilis 168: BSU16620
Entry
BSU16620          CDS       T00010                                 

Symbol
ylxQ
Name
(RefSeq) ribosomal protein YlxQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 939626
NCBI-ProteinID: NP_389544
Pasteur: BG10267
BSORF: BG10267
UniProt: P32729 A0A6M3ZG82
Structure
PDB: 
3V7Q

Position
1733687..1733989
AA seq 100 aa
MSGMEWFPLLGLANRARKVVSGEDLVIKEIRNARAKLVLLTEDASSNTAKKVTDKCNYYK
VPYKKVESRAVLGRSIGKEARVVVAVTDQGFANKLISLLD
NT seq 303 nt   +upstreamnt  +downstreamnt
atgtctggaatggaatggtttcccttgctgggtctggccaatcgagctcgtaaggtcgtg
tcaggcgaagacttggtaataaaagaaatcaggaatgcgcgtgcaaagcttgtcctgctt
acagaggatgcatcatctaacacagcaaaaaaagtaactgacaagtgcaattattataaa
gtcccttataaaaaagtcgagagtcgcgcggttcttggacgctctatcggtaaagaagcc
cgtgtcgttgtcgccgtcactgaccaaggttttgcgaataagctgatcagcttgctcgat
taa

DBGET integrated database retrieval system