KEGG   Bacillus subtilis subsp. subtilis 168: BSU16630
Entry
BSU16630          CDS       T00010                                 

Gene name
infB
Definition
(RefSeq) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsu03012]
    BSU16630 (infB)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU16630 (infB)
Translation factors [BR:bsu03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    BSU16630 (infB)
 Prokaryotic type
   BSU16630 (infB)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSU16630 (infB)
Motif
Pfam: IF-2 GTP_EFTU IF2_N MMR_HSR1 GTP_EFTU_D2 Arf Ras MMR_HSR1_Xtn SRPRB FeoB_N RsgA_GTPase PduV-EutP Roc Spt20 ATP_bind_1 GTP_EFTU_D4 CDC45
Other DBs
NCBI-GeneID: 939630
NCBI-ProteinID: NP_389545
Pasteur: BG10268
BSORF: BG10268
UniProt: P17889 A0A6M3ZBI5
Position
1734009..1736159
AA seq 716 aa
MAKMRVYEYAKALNVSSKEILTALKNMDLEVNNHMAMLEEKAIKKLDAKYKKGGAAAKSQ
KPAETNKNKQPQGVNQQSAGNQPNKIRDGKKNDVQNNQFNKNKKNNNNKKNKRNNNNNKN
QHQQKPVKPKKELPEKITFSGTLTVGALAEELGKEPSELIKKLMLLGVMATINQELDKDT
IELIASEYGVETEEVIVLEETELEKYEEPDNEEDLEIRPPVVTIMGHVDHGKTTLLDSIR
KTKVVEGEAGGITQHIGAYQIEENGKKITFLDTPGHAAFTTMRARGAEVTDITILVVAAD
DGVMPQTVEAINHAKAAEVPIIVAVNKIDKESANPDRVMQELTEYGLVPEAWGGETIFVP
LSALTGKGIDELVEMILLVSEVEELKANPNRQAKGTVIEAELDKGRGSVATLLVQTGTLH
VGDPIVVGNTFGRVRAMVNDIGRRVKTAGPSTPVEITGLNDVPQAGDQFLVFKDEKTARS
VGEARASKQLEEQRSDKAKLSLDDLFEQIKQGDVKDINLIVKADVQGSAEALTAALQKIE
VEGVKVKIIHTGVGAITESDIILASASNAIVIGFNVRPDGNAKSTAEAENVDIRLHRIIY
KVIDEIEAAMKGMLDPEYEEKVIGQVEVRQTFKVSKIGTIAGGYVTEGTITRDSGLRLIR
DGVVIFEGEVDVLKRFKDDVKEVSQGYECGITIKKYNDIREGDILEAFVMQEIERT
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggctaaaatgagagtatacgaatatgcaaaagcgttaaatgtttcaagtaaggaaatt
ttgaccgcactgaagaacatggatttagaagtgaataatcacatggccatgcttgaagaa
aaggccattaaaaagctagatgccaaatataaaaaaggcggcgcagctgctaaatctcaa
aagccagcagaaacgaacaaaaacaaacagccacaaggggttaatcagcaatcagctgga
aatcaaccaaataaaattcgagacggaaagaagaatgacgtgcagaataatcaatttaac
aaaaacaagaagaataacaacaacaaaaaaaataaacgcaacaacaacaataataaaaac
caacatcagcaaaagcctgtaaagccgaaaaaagagcttcctgagaaaattacattctct
ggcactttaacagttggcgcacttgctgaagagcttggcaaagagccttcagaactcatt
aaaaagctgatgcttcttggcgtaatggcaaccattaaccaagagcttgataaagacaca
atcgaactcattgcatcagaatatggtgttgaaacagaagaggtcattgtgcttgaagaa
acagagctggaaaaatacgaagagcctgataatgaagaggatcttgaaattcgtcctcct
gtcgtgacaatcatgggccacgttgaccatgggaaaacaacgcttcttgacagcatccgt
aaaacaaaggttgttgaaggggaagcaggcggaatcactcagcatatcggcgcttatcaa
attgaagagaacggcaagaaaatcacgttcttggatacaccgggccacgccgcatttaca
acaatgcgcgcacgcggtgcagaagtaactgatattacgattcttgtcgtagctgccgat
gacggtgtcatgccgcaaacagttgaagcgattaaccatgcaaaagcagcagaggttcca
atcatcgttgctgtgaataaaatagataaagaatccgcaaaccctgaccgtgtaatgcaa
gaactgacggaatacggacttgtccctgaagcttggggcggagaaaccatttttgtgccg
ctttccgctttaactggaaaaggcattgatgagctcgttgaaatgattttgcttgtcagt
gaggtagaggaactgaaagcgaatccgaatcgtcaggcaaaaggaacggttattgaagct
gaactcgataaaggcagagggtcagtcgcgacgttgctcgtacagactggaacactgcat
gtcggtgatccgatcgtagtcggcaatacatttggccgtgtccgtgcaatggtcaacgac
attggccgccgtgtgaaaactgccggcccgtcaactccggttgaaattaccggtttgaat
gatgtccctcaagcgggagaccaattccttgtctttaaggatgaaaaaacagctcgttct
gtcggtgaagcccgtgcttcgaaacagcttgaagagcagcgcagcgataaagcgaagctc
agtcttgatgatttatttgagcaaattaagcaaggtgatgtaaaagacatcaacctcatc
gtaaaagctgacgttcaaggatctgctgaagctttaacggctgcacttcaaaaaattgaa
gtagaaggcgttaaagtgaaaatcatccatacaggcgttggtgcgattactgaatcagac
attatcttggcatctgcttccaatgcaattgttatcgggtttaatgtgagaccggacgga
aatgctaagagtacggctgaagctgaaaatgtagatattcgacttcaccgtatcatttac
aaagtaatcgacgagattgaagctgccatgaaaggtatgcttgatcctgaatatgaagaa
aaagtaattggtcaagtagaagtacgccaaacattcaaagtatctaaaatcggtacaatt
gccggcggatatgttactgaaggaaccattacgcgcgacagcggcctccgtttaattcgt
gacggcgtcgtcatctttgaaggcgaagtagatgttctgaaacgctttaaagacgatgtg
aaagaagtttcacaaggctatgaatgtggtattacaattaagaaatacaatgacattcgt
gaaggtgacatccttgaagcgtttgtcatgcaagaaattgaaagaacgtga

DBGET integrated database retrieval system