KEGG   Bacillus subtilis subsp. subtilis 168: BSU16640
Entry
BSU16640          CDS       T00010                                 

Gene name
ylxP
Definition
(RefSeq) hypothetical protein
  KO
K09764  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU16640 (ylxP)
Motif
Pfam: DUF503
Other DBs
NCBI-GeneID: 939641
NCBI-ProteinID: NP_389546
Pasteur: BG10269
BSORF: BG10269
UniProt: P32730 A0A6M3ZB87
Position
1736156..1736434
AA seq 92 aa
MIGFAECECIIYDAGSLKEKRAVLKRILTRVQNKFNVSISEIGYQDTWQRTSFGIAAVSS
SRVQTEKELQRVLAFIDSFPEIERTITRTEWF
NT seq 279 nt   +upstreamnt  +downstreamnt
gtgatcggatttgcggagtgtgaatgcatcatttatgatgcaggatcgctaaaagaaaag
cgtgccgttctgaagcggattttaaccagggttcaaaacaagttcaatgtttcgatttcg
gagattggctatcaggacacctggcaaagaaccagcttcggaatcgccgctgtttcttcc
tctcgcgttcaaacagaaaaagaactgcagcgcgtcctagcgtttatcgattcttttcct
gaaattgaacggacgatcactaggacagagtggttttaa

DBGET integrated database retrieval system