KEGG   Bacillus subtilis subsp. subtilis 168: BSU16650
Entry
BSU16650          CDS       T00010                                 

Symbol
rbfA
Name
(RefSeq) ribosome-binding factor A
  KO
K02834  ribosome-binding factor A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU16650 (rbfA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU16650 (rbfA)
SSDB
Motif
Pfam: RBFA
Other DBs
NCBI-GeneID: 939635
NCBI-ProteinID: NP_389547
Pasteur: BG10270
BSORF: BG10270
UniProt: P32731 A0A6M4JJ61
Position
1736451..1736804
AA seq 117 aa
MSMRANRVGEQMKKELGDIISRKLKDPRIGFLTVTDVRVSGDLQIAKVYISVLGDEKKRE
EALKGLAKAKGFIRSEIGSRIRLRKTPEIEFEFDESIDYGNRIETLIHELHSEKPSE
NT seq 354 nt   +upstreamnt  +downstreamnt
ttgagtatgagagcaaaccgtgtcggcgagcaaatgaaaaaagaactcggtgatattatc
agccgcaagctgaaagacccgagaattggttttctgacagtaacggatgtacgtgtatca
ggtgatttgcaaattgcaaaggtgtatatctcggttctcggtgacgagaaaaaacgggaa
gaagcgctgaaagggctggcaaaagcgaaaggatttatccgatccgaaatcggcagccgc
atcagacttcgaaaaacgcctgaaattgaatttgagttcgatgaatcaatcgattacggg
aatcggatcgaaacactgattcacgaattacattcagagaaaccatctgaataa

DBGET integrated database retrieval system