KEGG   Bacillus subtilis subsp. subtilis 168: BSU16700Help
Entry
BSU16700          CDS       T00010                                 

Gene name
ylxY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 Glyco_hydro_57 PG_binding_4 Polysacc_deac_2
Motif
Other DBs
NCBI-GeneID: 939649
NCBI-ProteinID: NP_389552
Pasteur: BG11492
BSORF: BG11492
UniProt: P50850
Position
1741618..1742577
Genome map
AA seq 319 aa AA seqDB search
MYKKFVPFAVFLFLFFVSFEMMENPHALDYIGAMKKDTVTVTASKDPLYEELLQKAPEYE
VKPQNARIDKVWKSIPGYNGLKVNIEQSYKKMKQHGKFREKDLVYSQVKPSVHLESLQPE
PIYKGNPDKPMVAFLINVAWGNEYLEKMLPILQKHQVKATFFLEGNWVRNNVQLAKKIAK
DGHEIGNHSYNHPDMSKLTTGRISEQLDKTNEQIEQTIGVKPKWFAPPSGSFRKAVIDIA
AEKQMGTVMWTVDTIDWQKPAPSVLQTRVLSKIHNGAMILMHPTDPTAESLEALITQIKD
KGYALGTVTELMDETRLLK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaaaatttgtaccgtttgccgtttttttatttcttttttttgtctcatttgag
atgatggaaaatccgcatgcacttgattatataggggcaatgaaaaaagatacggtgact
gtcacggcgtcaaaagacccgttatatgaagaattgcttcaaaaagcgccggagtacgaa
gttaagccccagaatgcaagaattgataaagtgtggaaaagcattccaggctacaatgga
ttaaaggtcaatattgaacaatcatataaaaaaatgaaacagcatggtaagtttcgggaa
aaagatttggtgtacagtcaagtaaaaccaagtgttcatcttgagtcacttcagcctgag
cctatttataaaggaaatcctgacaaaccgatggtggcttttttaatcaatgtggcatgg
ggaaatgagtatttggaaaaaatgcttcctattctgcaaaagcaccaggttaaagctacg
ttctttttagaaggcaattgggtgagaaacaatgtacagctcgctaagaagattgcaaaa
gacggacatgaaatcggaaatcattcatacaatcatccggatatgagcaaactgactaca
ggaagaatttccgagcagctcgacaagactaatgaacaaatagaacaaacgatcggcgtt
aagccaaagtggttcgctccgccaagcggaagtttcagaaaagcggttatcgacattgca
gcagagaaacagatgggaacagtcatgtggacagttgatacaatcgattggcaaaagccg
gctccgtctgtacttcagacgagagtgttaagcaagatacataatggtgccatgatttta
atgcatccgactgaccctacggcggaaagtcttgaagcgctgattacacagataaaagac
aaaggatatgcgcttggaacagtcactgaactaatggatgaaacaagactattgaagtaa

DBGET integrated database retrieval system