KEGG   Bacillus subtilis subsp. subtilis 168: BSU16710
Entry
BSU16710          CDS       T00010                                 

Gene name
mlpA
Definition
(RefSeq) zinc protease YmxG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C Peptidase_M44
Other DBs
NCBI-GeneID: 938456
NCBI-ProteinID: NP_389553
Pasteur: BG10779
BSORF: BG10779
UniProt: Q04805
Position
1742617..1743846
AA seq 409 aa
MIKRYTCQNGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTKS
AREIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEK
NVVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYT
PDRVVISVAGNISDSFIKDVEKWFGSYEAKGKATGLEKPEFHTEKLTRKKETEQAHLCLG
FKGLEVGHERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYG
GTGANQLQQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNE
LLLGKHKTLDEIINELNAVNLERVNGLARQLFTEDYALALISPSGNMPS
NT seq 1230 nt   +upstreamnt  +downstreamnt
ttgattaaacgatatacgtgtcaaaatggtgtaagaattgtgctggaaaataacccgaca
gtccgttctgttgcgatcggcgtatggatcggcacaggttcgagacatgaaacgccggag
ataaacggaatttctcactttttagagcacatgttctttaaagggacgagcacaaaatct
gcacgcgagatagcagaatcttttgatcgtattggcggccaggtcaatgcgtttacttca
aaggaatatacctgctactatgcaaaggtgcttgacgagcatgcgaattacgcgctggac
gtattagcagatatgttctttcattcaacgtttgatgaaaacgagctgaaaaaagagaaa
aatgtagtatatgaagaaattaaaatgtatgaagatgcgccggacgacattgtacatgat
ttattgagcaaagccacttacggcaatcattctttaggctacccaattttaggaacggaa
gaaacgcttgcttcctttaacggtgactctctcagacaatacatgcatgattattatacg
ccggaccgagtggtgatttcggtagcgggcaatatatctgacagttttatcaaagatgta
gaaaaatggttcgggtcatacgaggcgaaaggcaaagcgacaggccttgagaagcctgag
ttccacacggaaaaactgacgagaaaaaaagaaacagagcaggctcatttgtgccttgga
tttaaaggcttagaggttggccatgaacgtatttatgatttaatcgtcctcaacaatgtg
ctcggaggcagcatgagcagccggctgttccaagatgtgcgtgaagataaaggacttgct
tattctgtttacagctatcacagctcatatgaggacagcggaatgctaacgatttacggc
ggaacgggtgcaaatcagcttcagcagctgtcggaaacaattcaagaaaccctggccaca
ttaaaacgtgacggcattacctcgaaagaactggaaaacagcaaagagcaaatgaaggga
agcttaatgctgagcttagaaagcacaaacagcaaaatgagccgaaacggaaaaaatgaa
ctgctgctcggcaaacataaaacattagatgaaattatcaatgaattaaacgccgtgaac
ttagagcgtgttaatggccttgccagacaattgtttaccgaagactatgcattagcactt
atcagcccttccggcaatatgccgtcttaa

DBGET integrated database retrieval system