KEGG   Bacillus subtilis subsp. subtilis 168: BSU16720
Entry
BSU16720          CDS       T00010                                 

Gene name
ymxH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PRC
Other DBs
NCBI-GeneID: 939648
NCBI-ProteinID: NP_389554
Pasteur: BG10780
BSORF: BG10780
UniProt: Q04811
Position
1743924..1744181
AA seq 85 aa
MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVP
WHHIQKIGSDMIILDVPEEMPPRQE
NT seq 258 nt   +upstreamnt  +downstreamnt
atgcggctcagtgaattatcgggaaaggaaattgtagacatcaaaagagctgaacggctc
ggagtgctcggccagaccgatttggaaatcaatgaacaggatggacagattacagcactc
ctcattcccacagttaagtggtttggtttgagaaagcaaggtcatgacattcgtgtccca
tggcaccatattcaaaagatcggttcagatatgattatattagatgtacctgaggaaatg
cctcctcgacaagagtaa

DBGET integrated database retrieval system