KEGG   Bacillus subtilis subsp. subtilis 168: BSU16730
Entry
BSU16730          CDS       T00010                                 

Symbol
spoVFA
Name
(RefSeq) dipicolinate synthase subunit A
  KO
K06410  dipicolinate synthase subunit A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU16730 (spoVFA)
SSDB
Motif
Pfam: DpaA_N AlaDh_PNT_C NAD_binding_7 2-Hacid_dh_C Shikimate_DH IlvN NAD_binding_2 Pyr_redox_2 F420_oxidored 3HCDH_N Pyr_redox THF_DHG_CYH_C TrkA_N NAD_Gly3P_dh_N AdoHcyase_NAD ApbA Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 939652
NCBI-ProteinID: NP_389555
Pasteur: BG10781
BSORF: BG10781
UniProt: Q04809 A0A6M4JGH6
Structure
PDB: 
2RIR

Position
1744367..1745260
AA seq 297 aa
MLTGLKIAVIGGDARQLEIIRKLTEQQADIYLVGFDQLDHGFTGAVKCNIDEIPFQQIDS
IILPVSATTGEGVVSTVFSNEEVVLKQDHLDRTPAHCVIFSGISNAYLENIAAQAKRKLV
KLFERDDIAIYNSIPTVEGTIMLAIQHTDYTIHGSQVAVLGLGRTGMTIARTFAALGANV
KVGARSSAHLARITEMGLVPFHTDELKEHVKDIDICINTIPSMILNQTVLSSMTPKTLIL
DLASRPGGTDFKYAEKQGIKALLAPGLPGIVAPKTAGQILANVLSKLLAEIQAEEGK
NT seq 894 nt   +upstreamnt  +downstreamnt
atgttaaccggattgaaaattgcagttatcggcggtgacgcaagacagctcgaaattata
agaaagctcactgaacagcaggctgacatctatcttgtcggttttgaccaattggatcac
ggttttaccggggcagtaaaatgcaatattgatgaaattccttttcagcaaatagacagc
atcattcttccagtatccgcgacaacaggagaaggtgtcgtatcgactgtattttcgaat
gaagaagttgtgttaaaacaggaccatcttgacagaacgcctgcacattgtgtcattttc
tcaggaatttctaacgcctatttagaaaacattgcagctcaggcaaaaagaaaacttgtt
aagctgtttgagcgggatgacattgcgatatacaactctattccgacagtagaaggaacg
atcatgctggctattcagcacacggattatacgatacacggatcacaggtggccgttctc
ggtctggggcgcaccgggatgacgattgcccgtacatttgccgcgctcggggcgaatgta
aaagtgggggcaagaagttcagcgcatctggcacgtatcactgaaatggggctcgttcct
tttcataccgatgagctgaaagagcatgtaaaagatatagatatttgcattaataccata
ccgagtatgattttaaatcaaacggtactttctagcatgacaccaaaaaccttaatattg
gatctggcctcacgtcccgggggaacggattttaaatatgccgagaaacaagggattaaa
gcacttcttgctcccgggcttccagggattgtcgctcctaaaacagctgggcaaatcctt
gcaaacgtcttgagcaagcttttggctgaaatacaagctgaggaggggaaataa

DBGET integrated database retrieval system