KEGG   Bacillus subtilis subsp. subtilis 168: BSU16740
Entry
BSU16740          CDS       T00010                                 

Gene name
spoVFB
Definition
(RefSeq) dipicolinate synthase subunit B
  KO
K06411  dipicolinate synthase subunit B
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU16740 (spoVFB)
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-GeneID: 939660
NCBI-ProteinID: NP_389556
Pasteur: BG10782
BSORF: BG10782
UniProt: Q04810
Position
1745263..1745865
AA seq 200 aa
MSSLKGKRIGFGLTGSHCTYEAVFPQIEELVNEGAEVRPVVTFNVKSTNTRFGEGAEWVK
KIEDLTGYEAIDSIVKAEPLGPKLPLDCMVIAPLTGNSMSKLANAMTDSPVLMAAKATIR
NNRPVVLGISTNDALGLNGTNLMRLMSTKNIFFIPFGQDDPFKKPNSMVAKMDLLPQTIE
KALMHQQLQPILVENYQGND
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtcgtcattaaaaggaaaaagaatcgggtttgggctgaccgggtcgcattgcacatat
gaagcggttttcccgcaaattgaggagttggtcaacgaaggagctgaagtccgtccggtt
gtcacatttaatgtaaaatctacaaatacccgatttggagagggcgcagaatgggttaaa
aaaattgaagacctgactggatatgaggccattgattcgattgtaaaggcagaacctctt
gggccgaagctgccccttgactgcatggtcattgcgcctttaacaggcaattcaatgagc
aagctggcaaatgccatgacggacagcccggtgctgatggcggcaaaagcgacaatccgg
aacaatcggcctgtcgttctgggtatctcgacaaatgatgctcttggtttaaacggaaca
aatttaatgaggctcatgtcaacaaaaaatatcttttttattccattcgggcaagatgat
ccatttaaaaaaccgaattcaatggtagccaaaatggatctgcttccgcaaacgattgaa
aaggcactcatgcaccagcagcttcagccgattctagttgagaattatcagggaaatgac
taa

DBGET integrated database retrieval system