KEGG   Bacillus subtilis subsp. subtilis 168: BSU16750
Entry
BSU16750          CDS       T00010                                 

Gene name
asd
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00261  Monobactam biosynthesis
bsu00270  Cysteine and methionine metabolism
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU16750 (asd)
   00270 Cysteine and methionine metabolism
    BSU16750 (asd)
   00300 Lysine biosynthesis
    BSU16750 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU16750 (asd)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     BSU16750 (asd)
SSDB
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh Gp_dh_C Ldh_1_N Sacchrp_dh_NADP DapB_N DXP_reductoisom Epimerase NAD_binding_10
Other DBs
NCBI-GeneID: 939654
NCBI-ProteinID: NP_389557
Pasteur: BG10783
BSORF: BG10783
UniProt: Q04797
Position
1745991..1747031
AA seq 346 aa
MGRGLHVAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEAS
PESFEGVNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADLHE
HNGIIANPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNK
EEIEPEIMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVAAT
CVRLPIQTGHSESVYIEIDRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVGKND
VFVGRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgggaagaggtttacacgtagctgttgtcggagcgacaggggctgtgggacaacaaatg
cttaaaacacttgaagacagaaactttgaaatggacacacttacattgctatcttcaaaa
cgctctgcggggacaaaagtcacgtttaaaggccaagagctgactgttcaggaagcttct
cctgagagctttgaaggggtaaatattgctttgttcagcgccggcggaagcgtatcacaa
gcattggcaccagaagctgtaaaacgcggcgctattgttatagataatacgagtgcgttc
cgcatggatgaaaatacaccgcttgttgtgccagaagtgaatgaggcagacttgcatgaa
cacaacggcattattgccaatccaaactgctctacaatccaaatggttgcggcacttgaa
ccgatccgcaaagcatatggcttaaacaaggtcatcgtatcaacttaccaggcagtatca
ggagcgggtaatgaagctgtaaaagagctttacagccaaacacaggcgattttaaataaa
gaagaaatagagcctgagatcatgcctgtaaaaggtgacaaaaaacactatcaaatcgcc
ttcaacgcgattccgcaaatcgataaattccaagataacggctatacgtttgaggaaatg
aaaatgataaatgaaacgaaaaaaatcatgcacatgcctgaccttcaagtagcggctaca
tgtgtgagactgccaatccaaactgggcactcagagtccgtctacatcgaaatagaccgt
gatgacgctacagttgaagatattaaaaatctattgaaagaagctccgggcgtgacactt
caggatgatccaagccagcagctttatccgatgcctgctgatgctgtcggcaaaaacgat
gtgtttgtaggccgcatccgcaaagacttggacagagcaaacggttttcatttatgggtt
gtttctgataacctattaaaaggcgcggcatggaactctgttcaaattgcagaaagcctg
aaaaaactaaacctcgtataa

DBGET integrated database retrieval system